US20120216317A1 · App 13/465,846

NUCLEOTIDE SEQUENCES AND POLYPEPTIDES ENCODED THEREBY USEFUL FOR INCREASING PLANT SIZE AND INCREASING THE NUMBER AND SIZE OF LEAVES

Publication

Country:US
Doc Number:20120216317
Kind:A1
Date:2012-08-23

Application

Country:US
Doc Number:13/465,846 (13465846)
Date:2012-05-07

Classifications

IPC Classifications

C12N15/82C07K14/415C12Q1/68A01H5/10C12N5/10C40B30/04C12N15/29A01H5/00

CPC Classifications

Applicants

Inventors

Abstract

Isolated polynucleotides and polypeptides encoded thereby are described, together with the use of those products for making transgenic plants that are characterized by increased size, have an increased number and size of rosette leaves and are late-flowering.

Ask AI about this patent

Get a summary, plain-language explanation, or ask your own question.

Figures

Description

FIELD OF THE INVENTION

[0001]The present invention relates to isolated polynucleotides, polypeptides encoded thereby, and the use of those products for making transgenic plants that are characterized by increased size, have an increased number and size of rosette leaves and are late-flowering.

BACKGROUND OF THE INVENTION

[0002]There are more than 300,000 species of plants. They show a wide diversity of forms, ranging from delicate liverworts, adapted for life in a damp habitat, to cacti, capable of surviving in the desert. The plant kingdom includes herbaceous plants, such as corn, whose life cycle is measured in months, to the giant redwood tree, which can live for thousands of years. This diversity reflects the adaptations of plants to survive in a wide range of habitats. This is seen most clearly in the flowering plants (phylum Angiospermophyta), which are the most numerous, with over 250,000 species. They are also the most widespread, being found from the tropics to the arctic.

[0003]The process of plant breeding involving man's intervention in natural breeding and selection is some 20,000 years old. It has produced remarkable advances in adapting existing species to serve new purposes. The world's economics was largely based on the successes of agriculture for most of these 20,000 years.

[0004]Plant breeding involves choosing parents, making crosses to allow recombination of gene (alleles) and searching for and selecting improved forms. Success depends on the genes/alleles available, the combinations required and the ability to create and find the correct combinations necessary to give the desired properties to the plant. Molecular genetics technologies are now capable of providing new genes, new alleles and the means of creating and selecting plants with the new, desired characteristics.

[0005]Great agronomic value can result from modulating the size of a plant as a whole or of any of its organs. For example, the green revolution came about as a result of creating dwarf wheat plants, which produced a higher seed yield than taller plants because they could withstand higher levels and inputs of fertilizer and water. Modulation of the size and stature of an entire plant or a particular portion of a plant allows productions of plants specifically improved for agriculture, horticulture and other industries. For example, reductions in height of specific ornamentals, crops and tree species can be beneficial, while increasing height of others may be beneficial.

[0006]Increasing the length of the floral stems of cut flowers in some species would also be useful, while increasing leaf size in others would be economically attractive. Enhancing the size of specific plant parts, such as seeds and fruit, to enhance yields by specifically stimulating hormone (e.g. Brassinolide) synthesis in these cells is beneficial. Another application is to stimulate early flowering by altering levels of gibberellic acid in specific cells. Changes in organ size and biomass also results in changes in the mass of constituent molecules.

[0007]To summarize, molecular genetic technologies provide the ability to modulate and manipulate plant size and stature of the entire plant as well as at the cell, tissue and organ levels. Thus, plant morphology can be altered to maximize the desired plant trait.

SUMMARY OF THE INVENTION

[0008]The present invention, therefore, relates to isolated polynucleotides, polypeptides encoded thereby, and the use of those products for making transgenic plants that are characterized by increased size, have an increased number and size of rosette leaves and are late-flowering, as compared to the non-transformed, wild-type plant.

[0009]The present invention also relates to processes for increasing the yield in plants, recombinant nucleic acid molecules and polypeptides used for these processes, their uses as well as to plants with an increased yield.

[0010]In the field of agriculture and forestry constantly efforts are being made to produce plants with an increased yield, in particular in order to guarantee the supply of the constantly increasing world population with food and to guarantee the supply of reproducible raw materials. Conventionally, it is tried to obtain plants with an increased yield by breeding, which is, however time-consuming and labor-intensive. Furthermore, appropriate breeding programs have to be performed for each relevant plant species.

[0011]Progress has partly been made by the genetic manipulation of plants, that is by introducing into and expressing recombinant nucleic acid molecules in plants. Such approaches have the advantage of usually not being limited to one plant species but being transferable to other plant species. In EP-A 0 511 979, e.g., it was described that the expression of a prokaryotic asparagine synthetase in plant cells inter alia leads to an increased biomass production. In WO 96/21737, e.g., the production of plants with an increased yield by the expression of deregulated or unregulated fructose-1,6-bisphosphatase due to the increase of the photosynthesis rate is described. Nevertheless, there still is a need of generally applicable processes for improving the yield in plants interesting for agriculture or forestry. Therefore, the present invention relates to a process for increasing the yield in plants, characterized in that recombinant DNA molecules stably integrated into the genome of plants are expressed.

[0012]It was surprisingly found that the expression of the proteins according to the invention specifically leads to an increase in yield.

[0013]The term “increase in yield” preferably relates to an increase of the biomass production, in particular when determined as the fresh weight of the plant. Such an increase in yield preferably refers to the so-called “sink” organs of the plant, which are the organs that take up the photoassimilates produced during photosynthesis. Particularly preferred are parts of plants which can be harvested, such as seeds, fruits, storage roots, roots, tubers, flowers, buds, shoots, stems or wood. The increase in yield according to the invention is at least 3% with regard to the biomass in comparison to non-transformed plants of the same genotype when cultivated under the same conditions, preferably at least 10% and particularly preferred at least 20%.

BRIEF DESCRIPTION OF THE FIGURES

[0014]FIG. 1 is a map of the DNA vector CRS 338 utilized in the transformation procedures described herein.

BRIEF DESCRIPTION OF THE INDIVIDUAL TABLES

Table—Reference Tables

[0015]The sequences of the instant invention are described in the Sequence Listing and the Reference Table (sometimes referred to as the REF Table. The Reference Table refers to a number of “Maximum Length Sequences” or “MLS.” Each MLS corresponds to the longest cDNA and is described in the Av subsection of the Reference Table.

[0016]The Reference Table includes the following information relating to each MLS:

[0017]
I. cDNA Sequence
    • [0018]A. 5′ UTR
    • [0019]B. Coding Sequence
    • [0020]C. 3′ UTR
[0021]
II. Genomic Sequence
    • [0022]A. Exons
    • [0023]B. Introns
    • [0024]C. Promoters

[0025]III. Link of cDNA Sequences to Clone IDs

[0026]IV. Multiple Transcription Start Sites

[0027]
V. Polypeptide Sequences
    • [0028]A. Signal Peptide
    • [0029]B. Domains
    • [0030]C. Related Polypeptides

[0031]VI. Related Polynucleotide Sequences

[0032]I. cDNA Sequence

[0033]The Reference Table indicates which sequence in the Sequence Table represents the sequence of each MLS. The MLS sequence can comprise 5′ and 3′ UTR as well as coding sequences. In addition, specific cDNA clone numbers also are included in the Reference Table when the MLS sequence relates to a specific cDNA clone.

[0034]A. 5′ UTR

[0035]The location of the 5′ UTR can be determined by comparing the most 5′ MLS sequence with the corresponding genomic sequence as indicated in the Reference Table. The sequence that matches, beginning at any of the transcriptional start sites and ending at the last nucleotide before any of the translational start sites corresponds to the 5′ UTR.

[0036]B. Coding Region

[0037]The coding region is the sequence in any open reading frame found in the MLS. Coding regions of interest are indicated in the PolyP SEQ subsection of the Reference Table.

[0038]C. 3′ UTR

[0039]The location of the 3′ UTR can be determined by comparing the most 3′ MLS sequence with the corresponding genomic sequence as indicated in the Reference Table. The sequence that matches, beginning at the translational stop site and ending at the last nucleotide of the MLS corresponds to the 3′ UTR.

[0040]II. Genomic Sequence

[0041]Further, the Reference Table indicates the specific “gi” number of the genomic sequence if the sequence resides in a public databank. For each genomic sequence, Reference tables indicate which regions are included in the MLS. These regions can include the 5′ and 3′ UTRs as well as the coding sequence of the MLS. See, for example, the scheme below:

embedded image

[0042]The Reference Table reports the first and last base of each region that are included in an MLS sequence. An example is shown below:

[0043]gi No. 47000:

[0044]37102 . . . 37497

[0045]37593 . . . 37925

[0046]The numbers indicate that the MLS contains the following sequences from two regions of gi No. 47000; a first region including bases 37102-37497, and a second region including bases 37593-37925.

[0047]A. Exon Sequences

[0048]The location of the exons can be determined by comparing the sequence of the regions from the genomic sequences with the corresponding MLS sequence as indicated by the Reference Table.

[0049]i. Initial Exon

[0050]To determine the location of the initial exon, information from the

[0051](1) polypeptide sequence section;

[0052](2) cDNA polynucleotide section; and

[0053](3) the genomic sequence section

[0054]of the Reference Table is used. First, the polypeptide section will indicate where the translational start site is located in the MLS sequence. The MLS sequence can be matched to the genomic sequence that corresponds to the MLS. Based on the match between the MLS and corresponding genomic sequences, the location of the translational start site can be determined in one of the regions of the genomic sequence. The location of this translational start site is the start of the first oxen.

[0055]Generally, the last base of the exon of the corresponding genomic region, in which the translational start site was located, will represent the end of the initial exon. In some cases, the initial exon will end with a stop codon, when the initial exon is the only exon.

[0056]In the case when sequences representing the MLS are in the positive strand of the corresponding genomic sequence, the last base will be a larger number than the first base. When the sequences representing the MLS are in the negative strand of the corresponding genomic sequence, then the last base will be a smaller number than the first base.

[0057]ii. Internal Exons

[0058]Except for the regions that comprise the 5′ and 3′ UTRs, initial exon, and terminal exon, the remaining genomic regions that match the MLS sequence are the internal exons. Specifically, the bases defining the boundaries of the remaining regions also define the intron/exon junctions of the internal exons,

[0059]iii. Terminal Exon

[0060]As with the initial exon, the location of the terminal exon is determined with information from the

[0061](1) polypeptide sequence section;

[0062](2) cDNA polynucleotide section; and

[0063](3) the genomic sequence section

[0064]of the Reference Table. The polypeptide section will indicate where the stop codon is located in the MLS sequence. The MLS sequence can be matched to the corresponding genomic sequence. Based on the match between MLS and corresponding genomic sequences, the location of the stop codon can be determined in one of the regions of the genomic sequence. The location of this stop codon is the end of the terminal exon. Generally, the first base of the exon of the corresponding genomic region that matches the cDNA sequence, in which the stop codon was located, will represent the beginning of the terminal exon. In some cases, the translational start site will represent the start of the terminal exon, which will be the only exon.

[0065]In the case when the MLS sequences are in the positive strand of the corresponding genomic sequence, the last base will be a larger number than the first base. When the MLS sequences are in the negative strand of the corresponding genomic sequence, then the last base will be a smaller number than the first base.

[0066]B. Intron Sequences

[0067]In addition, the introns corresponding to the MLS are defined by identifying the genomic sequence located between the regions where the genomic sequence comprises exons. Thus, introns are defined as starting one base downstream of a genomic region comprising an exon, and end one base upstream from a genomic region comprising an exon.

[0068]C. Promoter Sequences

[0069]As indicated below, promoter sequences corresponding to the MLS are defined as sequences upstream of the first exon; more usually, as sequences upstream of the first of multiple transcription start sites; even more usually as sequences about 2,000 nucleotides upstream of the first of multiple transcription start sites.

[0070]III. Link of cDNA Sequences to Clone IDs

[0071]As noted above, the Reference Table identifies the cDNA clone(s) that relate to each MLS. The MLS sequence can be longer than the sequences included in the cDNA clones. In such a case, the Reference Table indicates the region of the MLS that is included in the clone. If either the 5′ or 3′ termini of the cDNA clone sequence is the same as the MLS sequence, no mention will be made.

[0072]IV. Multiple Transcription Start Sites

[0073]Initiation of transcription can occur at a number of sites of the gene. The Reference Table indicates the possible multiple transcription sites for each gene. In the Reference Table, the location of the transcription start sites can be either a positive or negative number.

[0074]The positions indicated by positive numbers refer to the transcription start sites as located in the MLS sequence. The negative numbers indicate the transcription start site within the genomic sequence that corresponds to the MLS.

[0075]To determine the location of the transcription start sites with the negative numbers, the MLS sequence is aligned with the corresponding genomic sequence. In the instances when a public genomic sequence is referenced, the relevant corresponding genomic sequence can be found by direct reference to the nucleotide sequence indicated by the “gi” number shown in the public genomic DNA section of the Reference Table. When the position is a negative number, the transcription start site is located in the corresponding genomic sequence upstream of the base that matches the beginning of the MLS sequence in the alignment. The negative number is relative to the first base of the MLS sequence which matches the genomic sequence corresponding to the relevant “gi” number.

[0076]In the instances when no public genomic DNA is referenced, the relevant nucleotide sequence for alignment is the nucleotide sequence associated with the amino acid sequence designated by “gi” number of the later PolyP SEQ subsection.

[0077]V. Polypeptide Sequences

[0078]The PolyP SEQ subsection lists SEQ ID NOS. and Ceres SEQ ID NO for polypeptide sequences corresponding to the coding sequence of the MLS sequence and the location of the translational start site with the coding sequence of the MLS sequence.

[0079]The MLS sequence can have multiple translational start sites and can be capable of producing more than one polypeptide sequence.

[0080]Subsection (Dp) provides (where present) information concerning amino acid sequences that are found to be related and have some percentage of sequence identity to the polypeptide sequences of the Reference and Sequence Tables. These related sequences are identified by a “gi” number.

Tables 3 and 4—Protein Group Matrix Table

[0081]In addition to each consensus sequence of the invention (see below), Applicants have generated a scoring matrix to provide further description of the consensus sequence. The first row of each matrix indicates the residue position in the consensus sequence. The matrix reports the number of occurrences of all the amino acids that were found in the group members for every residue position of the signature sequence. The matrix also indicates for each residue position, how many different organisms were found to have a polypeptide in the group that included a residue at the relevant position. The last line of the matrix indicates all the amino acids that were found at each position of the consensus.

DETAILED DESCRIPTION OF THE INVENTION

1. Definitions

[0082]The following terms are utilized throughout this application:

Allelic variant: An “allelic variant” is an alternative form of the same SDF, which resides at the same chromosomal locus in the organism. Allelic variations can occur in any portion of the gene sequence, including regulatory regions. Allelic variants can arise by normal genetic variation in a population. Allelic variants can also be produced by genetic engineering methods. An allelic variant can be one that is found in a naturally occurring plant, including a cultivar or ecotype. An allelic variant may or may not give rise to a phenotypic change, and may or may not be expressed. An allele can result in a detectable change in the phenotype of the trait represented by the locus. A phenotypically silent allele can give rise to a product.
Chimeric: The term “chimeric” is used to describe genes, as defined supra, or constructs wherein at least two of the elements of the gene or construct, such as the promoter and the coding sequence and/or other regulatory sequences and/or filler sequences and/or complements thereof, are heterologous to each other.
Constitutive Promoter: Promoters referred to herein as “constitutive promoters” actively promote transcription under most, but not necessarily all, environmental conditions and states of development or cell differentiation. Examples of constitutive promoters include the cauliflower mosaic virus (CaMV) 35S transcript initiation region and the 1′ or 2′ promoter derived from T-DNA of Agrobacterium tumefaciens, and other transcription initiation regions from various plant genes, such as the maize ubiquitin-1 promoter, known to those of skill.
Coordinately Expressed: The term “coordinately expressed,” as used in the current invention, refers to genes that are expressed at the same or a similar time and/or stage and/or under the same or similar environmental conditions.
Domain: Domains are fingerprints or signatures that can be used to characterize protein families and/or parts of proteins. Such fingerprints or signatures can comprise conserved (1) primary sequence, (2) secondary structure, and/or (3) three-dimensional conformation. Generally, each domain has been associated with either a family of proteins or motifs. Typically, these families and/or motifs have been correlated with specific in-vitro and/or in-vivo activities. A domain can be any length, including the entirety of the sequence of a protein. Detailed descriptions of the domains, associated families and motifs, and correlated activities of the polypeptides of the instant invention are described below. Usually, the polypeptides with designated domain(s) can exhibit at least one activity that is exhibited by any polypeptide that comprises the same domain(s).
Endogenous: The term “endogenous,” within the context of the current invention refers to any polynucleotide, polypeptide or protein sequence which is a natural part of a cell or organisms regenerated from said cell.
Exogenous: “Exogenous,” as referred to within, is any polynucleotide, polypeptide or protein sequence, whether chimeric or not, that is initially or subsequently introduced into the genome of an individual host cell or the organism regenerated from said host cell by any means other than by a sexual cross. Examples of means by which this can be accomplished are described below, and include Agrobacterium-mediated transformation (of dicots—e.g. Salomon et al. EMBO J. 3:141 (1984); Herrera-Estrella et al. EMBO J. 2:987 (1983); of monocots, representative papers are those by Escudero et al., Plant J. 10:355 (1996), Ishida et al., Nature Biotechnology 14:745 (1996), May et al., Bio/Technology 13:486 (1995)), biolistic methods (Armaleo et al., Current Genetics 17:97 1990)), electroporation, in planta techniques, and the like. Such a plant containing the exogenous nucleic acid is referred to here as a T0 for the primary transgenic plant and T1 for the first generation. The term “exogenous” as used herein is also intended to encompass inserting a naturally found element into a non-naturally found location.
Gene: The term “gene,” as used in the context of the current invention, encompasses all regulatory and coding sequence contiguously associated with a single hereditary unit with a genetic function. Genes can include non-coding sequences that modulate the genetic function that include, but are not limited to, those that specify polyadenylation, transcriptional regulation, DNA conformation, chromatin conformation, extent and position of base methylation and binding sites of proteins that control all of these. Genes comprised of “exons” (coding sequences), which may be interrupted by “introns” (non-coding sequences), encode proteins. A gene's genetic function may require only RNA expression or protein production, or may only require binding of proteins and/or nucleic acids without associated expression. In certain cases, genes adjacent to one another may share sequence in such a way that one gene will overlap the other. A gene can be found within the genome of an organism, artificial chromosome, plasmid, vector, etc., or as a separate isolated entity.
Heterologous sequences: “Heterologous sequences” are those that are not operatively linked or are not contiguous to each other in nature. For example, a promoter from corn is considered heterologous to an Arabidopsis coding region sequence. Also, a promoter from a gene encoding a growth factor from corn is considered heterologous to a sequence encoding the corn receptor for the growth factor. Regulatory element sequences, such as UTRs or 3′ end termination sequences that do not originate in nature from the same gene as the coding sequence originates from, are considered heterologous to said coding sequence. Elements operatively linked in nature and contiguous to each other are not heterologous to each other. On the other hand, these same elements remain operatively linked but become heterologous if other filler sequence is placed between them. Thus, the promoter and coding sequences of a corn gene expressing an amino acid transporter are not heterologous to each other, but the promoter and coding sequence of a corn gene operatively linked in a novel manner are heterologous.
Homologous gene: In the current invention, “homologous gene” refers to a gene that shares sequence similarity with the gene of interest. This similarity may be in only a fragment of the sequence and often represents a functional domain such as, examples including without limitation a DNA binding domain, a domain with tyrosine kinase activity, or the like. The functional activities of homologous genes are not necessarily the same.
Inducible Promoter: An “inducible promoter” in the context of the current invention refers to a promoter which is regulated under certain conditions, such as light, chemical concentration, protein concentration, conditions in an organism, cell, or organelle, etc. A typical example of an inducible promoter, which can be utilized with the polynucleotides of the present invention, is PARSK1, the promoter from the Arabidopsis gene encoding a serine-threonine kinase enzyme, and which promoter is induced by dehydration, abscissic acid and sodium chloride (Wang and Goodman, Plant J. 8:37 (1995)). Examples of environmental conditions that may affect transcription by inducible promoters include anaerobic conditions, elevated temperature, or the presence of light.
Orthologous Gene: In the current invention “orthologous gene” refers to a second gene that encodes a gene product that performs a similar function as the product of a first gene. The orthologous gene may also have a degree of sequence similarity to the first gene. The orthologous gene may encode a polypeptide that exhibits a degree of sequence similarity to a polypeptide corresponding to a first gene. The sequence similarity can be found within a functional domain or along the entire length of the coding sequence of the genes and/or their corresponding polypeptides.
Percentage of sequence identity: “Percentage of sequence identity,” as used herein, is determined by comparing two optimally aligned sequences over a comparison window, where the fragment of the polynucleotide or amino acid sequence in the comparison window may comprise additions or deletions (e.g., gaps or overhangs) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Add. APL. Math. 2:482 (1981), by the homology alignment algorithm of Needleman and Wunsch J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman Proc. Natl. Acad. Sci. (USA) 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, PASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection. Given that two sequences have been identified for comparison, GAP and BESTFIT are preferably employed to determine their optimal alignment. Typically, the default values of 5.00 for gap weight and 0.30 for gap weight length are used. The term “substantial sequence identity” between polynucleotide or polypeptide sequences refers to polynucleotide or polypeptide comprising a sequence that has at least 80% sequence identity, preferably at least 85%, more preferably at least 90% and most preferably at least 95%, even more preferably, at least 96%, 97%, 98% or 99% sequence identity compared to a reference sequence using the programs.
Plant Promoter: A “plant promoter” is a promoter capable of initiating transcription in plant cells and can drive or facilitate transcription of a fragment of the SDF of the instant invention or a coding sequence of the SDF of the instant invention. Such promoters need not be of plant origin. For example, promoters derived from plant viruses, such as the CaMV35S promoter or from Agrobacterium tumefaciens such as the T-DNA promoters, can be plant promoters. A typical example of a plant promoter of plant origin is the maize ubiquitin-1 (ubi-1) promoter known to those of skill.
Promoter: The term “promoter,” as used herein, refers to a region of sequence determinants located upstream from the start of transcription of a gene and which are involved in recognition and binding of RNA polymerase and other proteins to initiate and modulate transcription. A basal promoter is the minimal sequence necessary for assembly of a transcription complex required for transcription initiation. Basal promoters frequently include a “TATA box” element usually located between 15 and 35 nucleotides upstream from the site of initiation of transcription. Basal promoters also sometimes include a “CCAAT box” element (typically a sequence CCAAT) and/or a GGGCG sequence, usually located between 40 and 200 nucleotides, preferably 60 to 120 nucleotides, upstream from the start site of transcription.
Regulatory Sequence: The term “regulatory sequence,” as used in the current invention, refers to any nucleotide sequence that influences transcription or translation initiation and rat; and stability and/or mobility of the transcript or polypeptide product. Regulatory sequences include, but are not limited to, promoters, promoter control elements, protein binding sequences, 5′ and 3′ UTRs, transcriptional start site, termination sequence, polyadenylation sequence, introns, certain sequences within a coding sequence, etc.
Signal Peptide: A “signal peptide” as used in the current invention is an amino acid sequence that targets the protein for secretion, for transport to an intracellular compartment or organelle or for incorporation into a membrane. Signal peptides are indicated in the tables and a more detailed description located below.
Specific Promoter: In the context of the current invention, “specific promoters” refers to a subset of inducible promoters that have a high preference for being induced in a specific tissue or cell and/or at a specific time during development of an organism. By “high preference” is meant at least 3-fold, preferably 5-fold, more preferably at least 10-fold still more preferably at least 20-fold, 50-fold or 100-fold increase in transcription in the desired tissue over the transcription in any other tissue. Typical examples of temporal and/or tissue specific promoters of plant origin that can be used with the polynucleotides of the present invention, are: PTA29, a promoter which is capable of driving gene transcription specifically in tapetum and only during anther development (Koltonow et al., Plant Cell 2:1201 (1990); RCc2 and RCc3, promoters that direct root-specific gene transcription in rice (Xu et al., Plant Mol. 27:237 (1995); TobRB27, a root-specific promoter from tobacco (Yamamoto et al., Plant Cell 3:371 (1991)). Examples of tissue-specific promoters under developmental control include promoters that initiate transcription only in certain tissues or organs, such as root, ovule, fruit, seeds, or flowers. Other suitable promoters include those from genes encoding storage proteins or the lipid body membrane protein, oleosin. A few root-specific promoters are noted above.
Stringency: “Stringency” as used herein is a function of probe length, probe composition (G+C content), and salt concentration, organic solvent concentration, and temperature of hybridization or wash conditions. Stringency is typically compared by the parameter Tm, which is the temperature at which 50% of the complementary molecules in the hybridization are hybridized, in terms of a temperature differential from Tm. High stringency conditions are those providing a condition of Tm−5° C. to Tm−10° C. Medium or moderate stringency conditions are those providing Tm−20° C. to Tm−29° C. Low stringency conditions are those providing a condition of Tm−40° C. to Tm−48° C. The relationship of hybridization conditions to Tm (in ° C.) is expressed in the mathematical equation


Tm=81.5−16.6(log10[Na+])+0.41(% G+C)−(600/N)  (1)

where N is the length of the probe. This equation works well for probes 14 to 70 nucleotides in length that are identical to the target sequence. The equation below for Tm of DNA-DNA hybrids is useful for probes in the range of 50 to greater than 500 nucleotides, and for conditions that include an organic solvent (formamide).


Tm=81.5+16.6 log {[Na+]/(1+0.7[Na+])}+0.41(% G+C)−500/L0.63(% formamide)  (2)

where L is the length of the probe in the hybrid. (P. Tijessen, “Hybridization with Nucleic Acid Probes” in Laboratory Techniques in Biochemistry and Molecular Biology, P. C. vand der Vliet, ed., c. 1993 by Elsevier, Amsterdam.) The Tm of equation (2) is affected by the nature of the hybrid; for DNA-RNA hybrids Tm is 10-15° C. higher than calculated, for RNA-RNA hybrids Tm is 20-25° C. higher. Because the Tm decreases about 1° C. for each 1% decrease in homology when a long probe is used (Bonner et al., J. Mol. Biol. 81:123 (1973)), stringency conditions can be adjusted to favor detection of identical genes or related family members.

[0083]Equation (2) is derived assuming equilibrium and therefore, hybridizations according to the present invention are most preferably performed under conditions of probe excess and for sufficient time to achieve equilibrium. The time required to reach equilibrium can be shortened by inclusion of a hybridization accelerator such as dextran sulfate or another high volume polymer in the hybridization buffer.

[0084]Stringency can be controlled during the hybridization reaction or after hybridization has occurred by altering the salt and temperature conditions of the wash solutions used. The formulas shown above are equally valid when used to compute the stringency of a wash solution. Preferred wash solution stringencies lie within the ranges stated above; high stringency is 5-8° C. below Tm, medium or moderate stringency is 26-29° C. below Tm and low stringency is 45-48° C. below Tm.

Substantially free of: A composition containing A is “substantially free of” B when at least 85% by weight of the total A+B in the composition is A. Preferably, A comprises at least about 90% by weight of the total of A+B in the composition, more preferably at least about 95% or even 99% by weight. For example, a plant gene or DNA sequence can be considered substantially free of other plant genes or DNA sequences.
Translational start site: In the context of the current invention, a “translational start site” is usually an ATG in the cDNA transcript, more usually the first ATG. A single cDNA, however, may have multiple translational start sites.
Transcription start site: “Transcription start site” is used in the current invention to describe the point at which transcription is initiated. This point is typically located about 25 nucleotides downstream from a TFIID binding site, such as a TATA box. Transcription can initiate at one or more sites within the gene, and a single gene may have multiple transcriptional start sites, some of which may be specific for transcription in a particular cell-type or tissue.
Untranslated region (UTR): A “UTR” is any contiguous series of nucleotide bases that is transcribed, but is not translated. These untranslated regions may be associated with particular functions such as increasing mRNA message stability. Examples of UTRs include, but are not limited to polyadenylation signals, terminations sequences, sequences located between the transcriptional start site and the first exon (5′ UTR) and sequences located between the last exon and the end of the mRNA (3′ UTR).
Variant: The term “variant” is used herein to denote a polypeptide or protein or polynucleotide molecule that differs from others of its kind in some way. For example, polypeptide and protein variants can consist of changes in amino acid sequence and/or charge and/or post-translational modifications (such as glycosylation, etc),

2. Important Characteristics of the Polynucleotides of the Invention

[0085]The genes and polynucleotides of the present invention are of interest because when they are misexpressed (i.e. when expressed at a non-material location or in an increased amount) they produce plants with increased height, increased primary inflorescence thickness, an increase in the number and size of leaves, particularly rosette leaves, and a delay in flowering time without reduction in fertility. These traits can be used to exploit or maximize plant products. For example, an increase in plant height is beneficial in species grown or harvested for their main stem or trunk, such as ornamental cut flowers, fiber crops (e.g. flax, kenaf, hesperaloe, hemp) and wood producing trees. Increase in inflorescence thickness is also desirable for some ornamentals, while increases in the number and size of leaves can lead to increased production/harvest from leaf crops such as lettuce, spinach, cabbage and tobacco. The genes of the invention can also be used to increase the size of particular tissues/organs/organelles by placing the gene(s) under the control of a tissue/organ/organelle-specific promoter, to thereby increase particularly the size of the plant fruit and seed.

3. The Genes of the Invention

[0086]The sequences of the invention were isolated from Arabidopsis (polynucleotide and polypeptide SEQ ID NOS. 29-47), Maize (polynucleotide and polypeptide SEQ NOS. 1-14) and Brassica (polynucleotide and polypeptide SEQ ID NOS. 15-28), and are considered orthologous genes because the polypeptides perform similar functions in a transgenic plant.

[0087]Based upon the orthologous sequences, Applicants have determined that plants having the desired characteristics discussed above can be obtained by transformation of a plant or plant cell with a polynucleotide (stably integrated into the plant genome) that codes for a polypeptide that comprises one of the following consensus sequences:

(SEQ ID NO. 49)
(S,E)t<8>(E,G)<2-5>t<11-14>WT(N,D)E+H<2>Ya<1>(S,Y)aEtSFV<1>Q(L,S)<8-
83>(P,E)r<2-4>+<9-89>E<2>(D,G)QNF<2>n
(SEQ ID NO. 48)
V(E,K)tE(T,P)Ttt(M,G)(Y,I)t(A,K)G(K,N)(E,R)(Y,V)a<1>t<1-
4>WT(N,D)E+H<1>(L,S)Ya(K,S)SMEASFVnQL<0-
30>K(V,A)a<2>(G,E)<2>(Q,E)<9-19>(H,C)<1>(F,V)(L,P)<1>(S,N)PW<0-
2>a<1>+r+P<0-8>tD<2>(E,N)<8>(G,D)<0-6>S(G,P)t<1>t<2>+<6-
17>(Q,K)a<3>(E,S)<1-
3>EVtDQNF<2>n(G,E)(I,A)<1>t(E,S)(N,T)(G,E)t<1>K<2>K<1>(V,R)(M,R)aS
(E,R)t
[0088]
The consensus sequence contains both lower-case and upper-case letters. The upper-case letters represent the standard one-letter amino acid abbreviations. The lower case letters represent classes of amino acids:
    • [0089]“t” refers to tiny amino acids, which are specifically alanine, glycine, serine and threonine.
    • [0090]“p” refers to polar amino acids, which are specifically, asparagine and glutamine
    • [0091]“n” refers to negatively charged amino acids, which are specifically, aspartic acid and glutamic acid
    • [0092]“+” refers to positively charged residues, which are specifically, lysine, arginine, and histidine
    • [0093]“r” refers to aromatic residues, which are specifically, phenylalanine, tyrosine, and tryptophan,
    • [0094]“a” refers to aliphatic residues, which are specifically, isoleucine, valine, leucine, and methonine
    • [0095]“< >” refers to the number of residues present. For example, A <8>S indicates that eight residues separate the alanine residue from the serine residue. “A<8>S” is equivalent to “A XXXXX XXXS.” Likewise “A<1-3>S” indicates that at least one, but as many as three residues separate alanine from serine.

[0096]In addition to the sequences of SEQ ID NOS. 1-49, the invention also encompasses variants, fragments or fusions of the polypeptides that produce the same phenotypic effect after transformation into a host plant.

[0097]A type of variant of the polypeptides comprises amino acid substitutions. Conservative substitutions are preferred to maintain the function or activity of the polypeptide. Such substitutions include conservation of charge, polarity, hydrophobicity, size, etc. For example, one or more amino acid residues within the sequence can be substituted with another amino acid of similar polarity that acts as a functional equivalent, for example providing a hydrogen bond in an enzymatic catalysis. Substitutes for an amino acid within an exemplified sequence are preferably made among the members of the class to which the amino acid belongs. For example, the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine. The polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine. The positively charged (basic) amino acids include arginine, lysine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid.

[0098]The variants include those that have a percentage of sequence identity to SEQ NOS. 1-49 with the range of at least 80%, or preferably at least 85, 90, 95, 96, 97, 98 or 99%. Within that scope of percentage of sequence identity, a polypeptide of the invention may have additional individual amino acids or amino acid sequences inserted into the polypeptide in the middle thereof and/or at the N-terminal and/or C-terminal ends thereof, Likewise, some of the amino acids or amino acid sequences may be deleted from the polypeptide. Amino acid substitutions may also be made in the sequences; conservative substitutions being preferred.

[0099]One preferred class of variants are those that comprise (1) the domain of an encoded polypeptide and/or (2) residues conserved between the encoded polypeptide and related polypeptides. For this class of variants, the encoded polypeptide sequence is changed by insertion, deletion, or substitution at positions flanking the domain and/or conserved residues. Another class of variants includes those that comprise an encoded polypeptide sequence that is changed in the domain or conserved residues by a conservative substitution.

4. Use of the Genes to Make Transgenic Plants

[0100]To use the sequences of the present invention or a combination of them or parts and/or mutants and/or fusions and/or variants of them, recombinant DNA constructs are prepared which comprise the polynucleotide sequences of the invention inserted into a vector, and which are suitable for transformation of plant cells. The construct can be made using standard recombinant DNA techniques (Sambrook et al. 1989) and can be introduced to the species of interest by Agrobacterium-mediated transformation or by other means of transformation as referenced below.

[0101]
The vector backbone can be any of those typical in the art such as plasmids, viruses, artificial chromosomes, BACs, YACs and PACs and vectors of the sort described by
  • [0102](a) BAC: Shizuya et al., Proc. Natl. Acad. Sci. USA 89: 8794-8797 (1992); Hamilton et al., Proc. Natl. Acad. Sci. USA 93: 9975-9979 (1996);
  • [0103](b) YAC: Burke et al., Science 236:806-812 (1987);
  • [0104](c) PAC: Sternberg N. et al., Proc Natl Acad Sci USA. January; 87(1):103-7 (1990);
  • [0105](d) Bacteria-Yeast Shuttle Vectors: Bradshaw et al., Nucl Acids Res 23: 4850-4856 (1995);
  • [0106](e) Lambda Phage Vectors: Replacement Vector, e.g., Frischauf et al., J. Mol. Biol 170: 827-842 (1983); or Insertion vector, e.g., Huynh et al., In: Glover NM (ed) DNA Cloning: A practical Approach, Vol. 1 Oxford: IRL Press (1985); T-DNA gene fusion vectors: Walden et al., Mol Cell Biol 1: 175-194 (1990); and
  • [0107](g) Plasmid vectors: Sambrook et al., infra.

[0108]Typically, the construct will comprise a vector containing a sequence of the present invention with any desired transcriptional and/or translational regulatory sequences, such as promoters, UTRs, and 3′ end termination sequences. Vectors can also include origins of replication, scaffold attachment regions (SARs), markers, homologous sequences, introns, etc. The vector may also comprise a marker gene that confers a selectable phenotype on plant cells. The marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosulfuron or phosphinotricin.

[0109]A plant promoter fragment may be used that directs transcription of the gene in all tissues of a regenerated plant and may be a constitutive promoter, such as 355. Alternatively, the plant promoter may direct transcription of a sequence of the invention in a specific tissue (tissue-specific promoters) or may be otherwise under more precise environmental control (inducible promoters).

[0110]If proper polypeptide production is desired, a polyadenylation region at the 3′-end of the coding region is typically included. The polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA.

Knock-In Constructs

[0111]Ectopic expression of the sequences of the invention can also be accomplished using a “knock-in” approach. Here, the first component, an “activator line,” is created by generating a transgenic plant comprising a transcriptional activator operatively linked to a promoter. The second component comprises the desired cDNA sequence operatively linked to the target binding sequence/region of the transcriptional activator. The second component can be transformed into the “activator line” or be used to transform a host plant to produce a “target” line that can be crossed with the “activator line” by ordinary breeding methods. In either case, the result is the same. That is, the promoter drives production of the transcriptional activator protein that then binds to the target binding region to facilitate expression of the desired cDNA.

[0112]Any promoter that functions in plants can be used in the first component, such as the 35S Cauliflower Mosaic Virus promoter or a tissue or organ specific promoter. Suitable transcriptional activator polypeptides include, but are not limited to, those encoding HAP1 and GAL4. The binding sequence recognized and targeted by the selected transcriptional activator protein is used in the second component.

Transformation

[0113]Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature. See, e.g. Weising et al., Ann. Rev. Genet. 22:421 (1988); and Christou, Euphytica, v. 85, n. 1-3:13-27, (1995).

[0114]Processes for the transformation of monocotyledonous and dicotyledonous plants are known to the person skilled in the art. For the introduction of DNA into a plant host cell a variety of techniques is available. These techniques comprise the transformation of plant cells with T-DNA using Agrobacterium tumefaciens or Agrobacterium rhizogenes as transformation means, the fusion of protoplasts, the injection, the electroporation of DNA, the introduction of DNA by means of the biolistic method as well as further possibilities.

[0115]For the injection and electroporation of DNA in plant cells the plasmids do not have to fulfill specific requirements. Simple plasmids such as pUC derivatives can be used.

[0116]The use of agrobacteria for the transformation of plant cells has extensively been examined and sufficiently disclosed in the specification of EP-A 120 516, in Hoekema (In: The Binary Plant Vector System Offsetdrukkerij Kanters B. V., Alblasserdam (1985), Chapter V), Fraley et al. (Crit. Rev. Plant. Sci. 4, 1-46) and An et al. (EMBO J. 4 (1985), 277-287).

[0117]For the transfer of the DNA to the plant cell plant explants can be co-cultivated with Agrobacterium tumefaciens or Agrobacterium rhizogenes. From the infected plant material (for example leaf explants, segments of stems, roots but also protoplasts or suspension cultivated plant cells) whole plants can be regenerated in a suitable medium which may contain antibiotics or biozides for the selection of transformed cells. The plants obtained that way can then be examined for the presence of the introduced DNA. Other possibilities for the introduction of foreign DNA using the biolistic method or by protoplast transformation are known (cf., e.g., Willmitzer, L., 1993 Transgenic plants. In: Biotechnology, A Multi-Volume Comprehensive Treatise (H. J. Rehm, G. Reed, A. Pithier, P. Stadler, eds.), Vol. 2, 627-659, VCH Weinheim-New York-Basel-Cambridge).

[0118]The transformation of dicotyledonous plants via Ti-plasmid-vector systems with the help of Agrobacterium tumefaciens is well-established. Recent studies have indicated that also monocotyledonous plants can be transformed by means of vectors based on Agrobacterium (Chan et al., Plant Mol. Biol. 22 (1993), 491-506; Hiei et al., Plant J. 6 (1994), 271-282; Deng et al., Science in China 33 (1990), 28-34; Wilmink et al., Plant Cell Reports 11 (1992), 76-80; May et al., Bio/Technology 13 (1995), 486.492; Conner and Domisse; Int. J. Plant Sci. 153 (1992), 550-555; Ritchie et al., Transgenic Res. 2 (1993), 252-265).

[0119]Alternative systems for the transformation of monocotyledonous plants are the transformation by means of the biolistic method (Wan and Lemaux, Plant Physiol. 104 (1994), 37-48; Vasil et al., Bio/Technology 11 (1993), 1553-1558; Ritala et al., Plant Mol. Biol. 24 (1994), 317-325; Spencer et al., Theor. Appl. Genet. 79 (1990), 625-631), the protoplast transformation, the electroporation of partially permeabilized cells, as well as the introduction of DNA by means of glass fibers.

[0120]In particular the transformation of maize is described in the literature several times (cf., e.g., WO95/06128, EP 0 513 849; EP 0 465 875; Fromm et al., Biotechnology 8 (1990), 833-844; Gordon-Kamm et al., Plant Cell 2 (1990), 603-618; Koziel et al., Biotechnology 11 (1993), 194-200). In EP 292 435 and in Shillito et al. (Bio/Technology 7 (1989), 581) a process is described with the help of which and starting from a mucus-free, soft (friable) maize callus fertile plants can be obtained. Prioli and Söndahl (Bio/Technology 7 (1989), 589) describe the regenerating and obtaining of fertile plants from maize protoplasts of the Cateto maize inbred line Cat 100-1.

[0121]The successful transformation of other cereal species has also been described, for example for barley (Wan and Lemaux, see above; Ritala et al., see above) and for wheat (Nehra et al., Plant J. 5 (1994), 285-297).

[0122]Once the introduced DNA has been integrated into the genome of the plant cell, it usually is stable there and is also contained in the progenies of the originally transformed cell. It usually contains a selection marker which makes the transformed plant cells resistant to a biozide or an antibiotic such as kanamycin, G 418, bleomycin, hygromycin or phosphinotricin and others. Therefore, the individually chosen marker should allow the selection of transformed cells from cells lacking the introduced DNA.

[0123]The transformed cells grow within the plant in the usual way (see also McCormick et al., Plant Cell Reports 5 (1986), 81-84). The resulting plants can be cultured normally. Seeds can be obtained from the plants.

[0124]Two or more generations should be cultivated to make sure that the phenotypic feature is maintained stably and is transmitted. Seeds should be harvested to make sure that the corresponding phenotype or other properties are maintained.

[0125]DNA constructs of the invention may be introduced into the genome of the desired plant host by a variety of conventional techniques. For example, the DNA construct may be introduced directly into the genomic DNA of the plant cell using techniques such as electroporation and microinjection of plant cell protoplasts, or the DNA constructs can be introduced directly to plant tissue using ballistic methods, such as DNA particle bombardment. Alternatively, the DNA constructs may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria (McCormac et al., Mol. Biotechnol. 8:199 (1997); Hamilton, Gene 200:107 (1997)); Salomon et al. EMBO J. 3:141 (1984); Herrera-Estrella et al. EMBO J. 2:987 (1983).

[0126]Microinjection techniques are known in the art and well described in the scientific and patent literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al. EMBO J. 3:2717 (1984). Electroporation techniques are described in Fromm et al. Proc. Natl Acad. Sci. USA 82:5824 (1985). Ballistic transformation techniques are described in Klein et al. Nature 327:773 (1987). Agrobacterium tumefaciens-mediated transformation techniques, including disarming and use of binary or co-integrate vectors, are well described in the scientific literature. See, for example Hamilton, C M., Gene 200:107 (1997); Müller et al. Mol. Gen. Genet. 207:171 (1987); Komari et al. Plant J. 10:165 (1996); Venkateswarlu et al. Biotechnology 9:1103 (1991) and Gleave, A P., Plant Mol. Biol. 20:1203 (1992); Graves and Goldman, Plant Mol. Biol. 7:34 (1986) and Gould et al., Plant Physiology 95:426 (1991).

[0127]Transformed plant cells that have been obtained by any of the above transformation techniques can be cultured to regenerate a whole plant that possesses the transformed genotype and thus the desired phenotype. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker that has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture in “Handbook of Plant Cell Culture,” pp. 124-176, MacMillan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1988. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee et al. Ann. Rev. of Plant Phys, 38:467 (1987). Regeneration of monocots (rice) is described by Hosoyama et al. (Biosci. Biotechnol. Biochem. 58:1500 (1994)) and by Ghosh et al. (J. Biotechnol. 32:1 (1994)). The nucleic acids of the invention can be used to confer the trait of increased height, increased primary inflorescence thickness, an increase in the number and size of leaves and a delay in flowering time, without reduction in fertility, on essentially any plant.

[0128]The nucleotide sequences according to the invention can generally encode any appropriate proteins from any organism, in particular from plants, fungi, bacteria or animals. The sequences preferably encode proteins from plants or fungi. Preferably, the plants are higher plants, in particular starch or oil storing useful plants, for example potato or cereals such as rice, maize, wheat, barley, rye, triticale, oat, millet, etc., as well as spinach, tobacco, sugar beet, soya, cotton etc.

[0129]The process according to the invention can in principle be applied to any plant. Therefore, monocotyledonous as well as dicotyledonous plant species are particularly suitable. The process is preferably used with plants that are interesting for agriculture, horticulture and/or forestry.

[0130]Examples thereof are vegetable plants such as, for example, cucumber, melon, pumpkin, eggplant, zucchini, tomato, spinach, cabbage species, peas, beans, etc., as well as fruits such as, for example, pears, apples, etc.

[0131]Thus, the invention has use over a broad range of plants, including species from the genera Anacardium, Arachis, Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Cucumis, Cucurbita, Daucus, Elaeis, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Mahe, Manihot, Majorana, Medicago, Nicotiana, Olea, Oryza, Panieum, Pannesetum, Persea, Phaseolus, Pistachia, Pisum, Pyrus, Prunus, Raphanus, Ricinus, Secale, Senecio, Sinapis, Solanum, Sorghum, Theobromus, Trigonella, Triticum, Vicia, Vitis, Vigna, and Zea.

[0132]One of skill will recognize that after the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.

5. Phenotype Studies

[0133]The genes of the invention were utilized to transform plants (specifically Arabidopsis as a model species) and the results show the improved phenotype characteristics of the transgenic plants.

[0134]5.1. Phenotype Experiments for Clone 8490

[0135]
Ectopic expression of cDNA 12337825 (clone 8490—SEQ ID No. 39) under the control of the 35S promoter results in plants having a number of phenotypes including:
    • [0136]Taller plants
    • [0137]Thicker inflorescences
    • [0138]Larger rosettes
    • [0139]Increased rosette leaf number
    • [0140]Slightly delayed flowering

[0141]As a result, misexpression of cDNA 12337825 (SEQ ID No. 39) is useful to increase overall plant size/biomass. A gene with a direct role in controlling the size of an endosperm is also potentially advantageous for seed size and, if misexpressed with an appropriate promoter, for plant growth and development.

[0142]Clone 8490 contains cDNA 12337825, which when analyzed in transcript profiling (Txp) experiments (discussed below) was down-regulated in the root meristematic region of the plant relative to root cell elongation zone and up-regulated in an interploidy cross that stimulates endosperm (a paternal tetraploid gives rise to large endosperm and large seed).

Materials and Methods:

[0143]Generation and Phenotypic Evaluation of T1 and T2 Lines Containing 35S::cDNA 12337825.

[0144]Wild-type Arabidopsis Wassilewskija (WS) plants were transformed with a Ti plasmid containing cDNA 12337825 in the sense orientation relative to the 35S constitutive promoter. The Ti plasmid vector used for this construct, CRS 338 (FIG. 1), contains a plant selectable marker gene phosphinothricin acetyltransferase (PAT) that confers herbicide resistance to transformed plants. The transformation is conducted as follows:

Procedure: Agrobacterium -Mediated Transformation of Arabidopsis

Materials:

0.2% Phytagar

[0145]2 g Phytagar

[0146]1 L nanopure water

YEB (for 1 L)

[0147]5 g extract of meat

[0148]5 g Bacto peptone

[0149]1 g yeast extract

[0150]5 g sucrose

[0151]0.24 g magnesium sulfate

Infiltration Medium (IM) (for 1 L)

[0152]2.2 g MS salts

[0153]50 g sucrose

[0154]5 ul BAP solution (stock is 2 mg/ml)

Methods:

1. Stratification of WS-2 Seed.

    • [0155]Add 0.5 ml WS-2 (CS2360) seed to 50 ml of 0.2% Phytagar in a 50 ml Corning tube and vortex until seeds and Phytagar form a homogenous mixture.
    • [0156]Cover tube with foil and stratify at 4° C. for 3 days.

2. Preparation of Seed Mixture.

    • [0157]Obtain stratified seed from cooler.
    • [0158]Add seed mixture to a 1000 ml beaker.
    • [0159]Add an additional 950 ml of 0.2% Phytagar and mix to homogenize.

3. Preparation of Soil Mixture.

    • [0160]Mix 24 L SunshineMix #5 soil with 16 L Therm-O-Rock vermiculite in cement mixer to make a 60:40 soil mixture.
    • [0161]Amend soil mixture by adding 2 Tbsp Marathon and 3 Tbsp Osmocote and mix contents thoroughly.
    • [0162]Add 1 Tbsp Peters fertilizer to 3 gallons of water and add to soil mixture and mix thoroughly.
    • [0163]Fill 4-inch pots with soil mixture and round the surface to create a slight dome.
    • [0164]Cover pots with 8-inch squares of nylon netting and fasten using rubber bands.
    • [0165]Place 14 4-inch pots into each no-hole utility flat.

4. Planting.

    • [0166]Using a 60 ml syringe, aspirate 35 ml of the seed mixture.
    • [0167]Exude 25 drops of the seed mixture onto each pot.
    • [0168]Repeat until all pots have been seeded.
    • [0169]Place flats on greenhouse bench, cover flat with clear propagation domes, place 55% shade cloth on top of flats and subirrigate by adding 1 inch of water to bottom of each flat.

5. Plant Maintenance.

    • [0170]3 to 4 days after planting, remove clear lids and shade cloth.
    • [0171]Subirrigate flats with water as needed.
    • [0172]After 7-10 days, thin pots to 20 plants per pot using forceps.
    • [0173]After 2 weeks, subirrigate all plants with Peters fertilizer at a rate of 1 Tsp per gallon water.
    • [0174]When bolts are about 5-10 cm long, clip them between the first node and the base of stem to induce secondary bolts.
    • [0175]6 to 7 days after clipping, perform dipping infiltration.

6. Preparation of Agrobacterium.

    • [0176]Add 150 ml fresh YEB to 250 ml centrifuge bottles and cap each with a foam plug (Identi-Plug).
    • [0177]Autoclave for 40 min at 121° C.
    • [0178]After cooling to room temperature, uncap and add 0.1 ml each of carbenicillin, spectinomycin and rifampicin stock solutions to each culture vessel.
    • [0179]Obtain Agrobacterium starter block (96-well block with Agrobacterium cultures grown to an OD600 of approximately 1.0) and inoculate one culture vessel per construct by transferring 1 ml from appropriate well in the starter block.
    • [0180]Cap culture vessels and place on Lab-Line incubator shaker set at 27° C. and 250 RPM.
    • [0181]Remove after Agrobacterium cultures reach an OD600 of approximately 1.0 (about 24 hours), cap culture vessels with plastic caps, place in Sorvall SLA 1500 rotor and centrifuge at 8000 RPM for 8 min at 4° C.
    • [0182]Pour out supernatant and put bottles on ice until ready to use.
    • [0183]Add 200 ml Infiltration Media (IM) to each bottle, resuspend Agrobacterium pellets and store on ice.

7. Dipping Infiltration.

    • [0184]Pour resuspended Agrobacterium into 16 oz polypropylene containers.
    • [0185]Invert 4-inch pots and submerge the aerial portion of the plants into the Agrobacterium suspension and let stand for 5 min.
    • [0186]Pour out Agrobacterium suspension into waste bucket while keeping polypropylene container in place and return the plants to the upright position.
    • [0187]Place 10 covered pots per flat.
    • [0188]Fill each flat with 1-inch of water and cover with shade cloth.
    • [0189]Keep covered for 24 hr and then remove shade cloth and polypropylene containers.
    • [0190]Resume normal plant maintenance.
    • [0191]When plants have finished flowering cover each pot with a ciber plant sleeve.
    • [0192]After plants are completely dry, collect seed and place into 2.0 ml micro tubes and store in 100-place cryogenic boxes.

[0193]Ten independently transformed events were selected and evaluated for their qualitative phenotype in the T1 generation as follows:

Procedure: High Throughput Phenotypic Screening of Misexpression Mutants-T 1 Generation

[0194]
1. Soil Preparation. Wear gloves at all times.
    • [0195]In a large container, mix 60% autoclaved SunshineMix #5 with 40% vermiculite.
    • [0196]Add 2.5 Tbsp of Osmocote, and 2.5 Tbsp of 1% granular Marathon per 25 L of soil.
    • [0197]Mix thoroughly.

2. Fill Com-Packs With Soil.

    • [0198]Loosely fill D601 Corn-Packs level to the rim with the prepared soil.
    • [0199]Place filled pot into utility flat with holes, within a no-hole utility flat.
    • [0200]Repeat as necessary for planting. One flat set should contain 6 pots.

3. Saturate Soil.

    • [0201]Evenly water all pots until the soil is saturated and water is collecting in the bottom of the flats.
    • [0202]After the soil is completely saturated, dump out the excess water.

4. Plant the Seed.

5. Stratify the Seeds.

    • [0203]After sowing the seed for all the flats, place them into a dark 4° C. cooler.
    • [0204]Keep the flats in the cooler for 2 nights for WS seed. Other ecotypes may take longer. This cold treatment will help promote uniform germination of the seed.
      6. Remove Flats From Cooler and Cover With Shade Cloth. (Shade cloth is only needed in the greenhouse)
    • [0205]After the appropriate time, remove the flats from the cooler and place onto growth racks or benches.
    • [0206]Cover the entire set of flats with 55% shade cloth. The cloth is necessary to cut down the light intensity during the delicate germination period.
    • [0207]The cloth and domes should remain on the flats until the cotyledons have fully expanded. This usually takes about 4-5 days under standard greenhouse conditions.

7. Remove 55% Shade Cloth and Propagation Domes.

    • [0208]After the cotyledons have fully expanded, remove both the 55% shade cloth and propagation domes.
      8. Spray Plants With Finale Mixture. Wear gloves and protective clothing at all times.
    • [0209]Prepare working Finale mixture by mixing 3 ml concentrated Finale in 48 oz of water in the Poly-TEK sprayer.
    • [0210]Completely and evenly spray plants with a fine mist of the Finale mixture.
    • [0211]Repeat Finale spraying every 3-4 days until only transformants remain. (Approximately 3 applications are necessary.)
    • [0212]When satisfied that only transformants remain, discontinue Finale spraying.

9. Weed Out Excess Transformants.

    • [0213]Weed out excess transformants such that a maximum number of five plants per pot exist evenly spaced throughout the pot.
      10. Label Individual plants.

11. Screen Each Pot For Phenotypes.

    • [0214]When a phenotype is observed, label a tag describing the phenotype.
    • [0215]Repeat screening process at 4 development stages: Seedling, Rosette, Flowering, and Senescence.
      • [0216]Seedling—the time after the cotyledons have emerged, but before the 3rd true leaf begins to form.
      • [0217]Rosette—the time from the emergence of the 3rd true leaf through just before the primary bolt begins to elongate.
      • [0218]Flowering—the time from the emergence of the primary bolt to the onset of senescence (with the exception of noting the flowering time itself, most observations should be made at the stage where approximately 50% of the flowers have opened).
      • [0219]Senescence—the time following the onset of senescence (with the exception of “delayed senescence”, most observations should be made after the plant has completely dried).

12. Quality Control for T1 Overexpressers-Misexpression Lines.

13. Individual Plant Staking.

    • [0220]During the flowering stage of development, it is necessary to separate individual plants so that they do not entwine themselves, causing cross-contamination and making seed collection very difficult.
    • [0221]Place a Hyacinth stake in the soil next to the rosette, being careful not to damage the plant.
    • [0222]Carefully wrap the primary and secondary bolts around the stake.
    • [0223]Very loosely wrap a single plastic coated twist tie around the stake and the plant to hold it in place.

14. Seed Collection Preparation.

    • [0224]When senescence begins and flowers stop forming, stop watering. This will allow the plant to dry properly for seed collection.
      15. Collect Seed from Plants

[0225]Two events showing the most advantageous T1 phenotypes (large, late-flowering) were chosen for evaluation in the T2 generation. The T2 growth conditions follow the above T1 protocol. The experimental design differs from the T1 planting in that each T2 plant is contained within its own pot, and no herbicide selection is used. All pots for each T2 event are contained within the same flat and the plants are randomly distributed within each flat. The controls for each set of measurements are the segregating progeny of the given T1 event which do not contain the T-DNA (internal controls). All analyses are done via soil-based experiments under long day light conditions (16 hours) in the Ceres greenhouse.

[0226]
T2 measurements being taken are as follows:
    • [0227]Days to bolt=number of days between sowing of seed and emergence of first inflorescence.
    • [0228]Number of Leaves=number of rosette leaves present at date of first bolt.
    • [0229]Rosette Area=Area of rosette at time of initial bolt emergence, using ((L×W)*3.14)/4,
    • [0230]Primary Inflorescence Thickness=diameter of primary inflorescence 2.5 cm up from base. This measurement was taken at the termination of flowering/onset of senescence.
    • [0231]Height=length of longest inflorescence from base to apex. This measurement was taken at the termination of flowering/onset of senescence.

[0232]PCR was used to amplify the cDNA insert in one randomly chosen T1 plant. This PCR product was then sequenced to confirm that the correct insert was contained in the plants. The quality control process was performed as per standard protocol.

[0233]In the T2 generation, PCR was used to confirm the presence or absence of the insert in each plant. To confirm that genomic DNA was present in the reaction mixture, a second set of reactions was run for each sample using primers that amplify a sequence from the RAP2.7 gene. Each sample template yielding a PCR product for RAP2.7 was deemed of adequate template quality.

Results:

Qualitative Analysis of the T 1 Plants:

[0234]All ten events were late flowering, produced larger rosettes with more leaves and tall, thick inflorescences compared to the controls (see results in Table 5). The transgenic “control” was a set of different 35S::cDNA expressing plants which were indistinguishable from the untransformed WS wild type.

TABLE 5
Qualitative phenotypes observed
in 35S::cDNA 12337825 T1 events
Increased Rosette Size
Increased RosetteLateTall &amp;
EventLeaf NumberFloweringThick
ME03459-01xxx
ME03459-02xxx
ME03459-03xxx
ME03459-04xxx
ME03459-05xxx
ME03459-06xxx
ME04358-01xxx
ME04358-02xxx
ME04358-03xxx
ME04358-04xxx

Quantitative Analysis of the T 2 Plants:

[0235]Events ME03459-01 and ME03459-04 were evaluated in greater detail in the T2 generation. Seventeen individuals were sown and observed for event 01, whereas 18 individuals were sown and observed for event 04. The transgenic plants for both events showed increased height, increased primary inflorescence thickness, increased number of rosette leaves, a larger rosette, and delay of flowering time to a 0.05 level of statistical significance (Table 6). Both events had normal fertility. All plants noted in the table as ME03459-01 or ME03459-04 were segregating progeny of the T1 event which we had confirmed to contain the transgene under test. All plants noted in the table as −01 Control or −04 Control were T2 segregating progeny which did not contain the transgene under test (internal controls).

[0236]Both events produce significantly more seeds than the control, as would be expected for a typical, fertile, late flowering plant.

[0237]Event ME03459-01 is the strongest expresser as noted in Table 5. The rosette area, number of leaves, thickness of the inflorescence and days to bolt are all greater than event −04.

[0238]Segregation frequencies of the transgene under test suggest that each event contains a single insert, as calculated by a Chi-square test. The T2 seeds segregate 3R:1S for both events (data not shown).

TABLE 6
Quantitative phenotypes observed
in 35S::cDNA 12337825 T2 events
NumberPrimary
ofRosetteNumberInflorescenceDays
Event/Obser-AreaofHeightThicknessto
Controlvations(mm2)Leaves(cm)(inches)Bolt
ME03459-01147023.0*11.0*75.6*0.068*21.9*
-01 Control32348.58.052.20.05019.0
ME03459-0494977.7*9.4*68.9*0.055*20.8*
-04 Control52521.17.554.00.05118.1
*significantly different from control at 0.05 level, via t-test

Summary of Results

[0239]The ectopic expression of cDNA 12337825 with a strong constitutive promoter (35S) results in taller plants, with thicker inflorescences, a larger rosette, and more rosette leaves. 12337825 is normally regulated in shoot and root apices, suggesting that the encoded protein may help to regulate meristem function. The increase in plant size observed by this expression is accompanied by a delay in flowering time, but no reduction in fertility. It may also be a useful gene to increase root growth, given the similar expression pattern in shoot meristems and root tip cells.

[0240]Assuming conservation of process controlling vegetative growth across species, this gene and protein is likely to function similarly in other species. Increased vegetative biomass should give an improved source:sink ratio and improved fixation of carbon to sucrose and starch. It may in and of itself play into improved yield. Taller inflorescences give the opportunity for more flowers and therefore more seeds. The combination of improved biomass and inflorescence stature may give a significant improvement in yield. Thicker inflorescences may prevent against “snap” against wind, rain or drought. Biomass advantage and presumed photosynthesis advantage should be useful in corn and soybean.

[0241]Therefore, this gene/protein is especially useful for controlling the number/rate of cell division in meristems without disturbing overall plant morphology. It could be developed in crops with an appropriate promoter to regulate size and growth rate of many individual organs. The use of a tissue-specific promoter may be particularly desirable. For example, if an increase of leaf size is desired without an increase in root size, the coding sequences of the invention can be operably linked to a leaf specific promoter for this purpose. Alternatively, if an increase in plant size is desired with no change in flowering time, the coding sequences of the invention can be modulated with a leaf specific promoter that does not direct expression in the floral meristem.

[0242]The protein is useful for creating sturdier stems in corn and preventing against “snap”.

[0243]5.2. Phenotype Experiments for Clone 8161—cDNA 5662747

[0244]
Ectopic expression of Ceres cDNA 5662747(SEQ ID No. 29) under the control of the 35S promoter results in plants having a number of phenotypes including:
    • [0245]Taller plants
    • [0246]Thicker inflorescences
    • [0247]Qualitatively larger rosettes
    • [0248]Qualitatively increased rosette leaf number
    • [0249]Delayed flowering

[0250]As a result, misexpression of Ceres cDNA 5662747 (SEQ ID No. 29) is useful to increase overall plant size/biomass.

[0251]Clone 8161 contains cDNA 5662747, which when analyzed in transcript profiling experiments (discussed below) was down-regulated in both the shoot and root tips of the plant relative to whole plant mRNA extracts suggesting a function in meristem activity.

Materials and Methods:

[0252]Generation and Phenotypic Evaluation of T1 and T2 Lines Containing 35S::cDNA 5662747.

[0253]Wild-type Arabidopsis Wassilewskija (WS) plants were transformed with a Ti plasmid containing cDNA 5662747 in the sense orientation relative to the 35S constitutive promoter as per standard protocol (See “Ceres Protocol-Agrobacterium-Mediated Transformation of Arabidopsis”). The Ti plasmid vector used for this construct, CRS 311, contains a plant selectable marker gene phosphinothricin acetyltransferase (PAT) that confers herbicide resistance to transformed plants.

[0254]Ten independently transformed events were selected and evaluated for their qualitative phenotype in the T1 generation as per standard protocol. Three events showing the strongest T1 phenotypes were chosen for evaluation in the T2 generation. The T2 growth conditions followed the above T1 protocol. The experimental design differed from the T1 planting in that each T2 plant was contained with its own pot, and no herbicide selection was used. All the pots for each T2 event were contained within the same flat and the plants were randomly distributed within each flat. The controls for each set of measurements were the segregating progeny of other T1 events which did not contain this gene (internal controls). All analyses were done via soil-based experiments under long day light conditions (16 hours) in the Ceres greenhouse.

[0255]
T2 measurements were taken as follows:
    • [0256]Height=length of longest inflorescence from base to apex. This measurement was taken at the termination of flowering/onset of senescence.
    • [0257]Primary Inflorescence Thickness=diameter of primary inflorescence 2.5 cm up from base. This measurement was taken at the termination of flowering/onset of senescence.
    • [0258]Days to bolt=number of days between sowing of seed and eruption of first infloreseence.

[0259]PCR was used to amplify the cDNA insert in one randomly chosen T1 plant. This PCR product was then sequenced to confirm that the correct insert was contained in the plants. The quality control process was performed as per standard protocol.

[0260]In the T2 generation, PCR was used to confirm the presence or absence of the insert in each plant. To confirm that genomic DNA was present in the reaction mixture, a second set of reactions was run for each sample using primers that amplify a sequence from the RAP2.7 gene. Each sample template yielded a PCR product for RAP2.7, so all DNA samples were deemed of adequate template quality.

Results:

Qualitative Analysis of the T 1 Plants:

[0261]All ten events showed a variety of phenotypes different from wild-type transgenic controls (Table 7); obvious differences from the controls were noted. The transgenic “control” was a set of different 35S::cDNA expressing plants which were indistinguishable from the untransformed WS wildtype. The most pronounced variant phenotype was that of reduced secondary inflorescence formation, slightly delayed flowering time, larger rosettes with more leaves, and tall, thick inflorescences. This pot of plants was used only to provide a size comparison.

TABLE 7
Qualitative phenotypes observed in 35S::cDNA 5662747 T1 events
Increased RosetteReduced
Size IncreasedLateSecondary
Rosette LeafFlower-Inflor.Tall &amp;Fertility
EventNumberingFormationThickDefects
ME01795-01xxxx
ME01795-02xxx
ME01795-03x
ME01795-04xxxx
ME01795-05x
ME01795-06xxxx
ME01795-07xxx
ME01795-08x
ME01795-09x
ME01795-10xxxx

Quantitative Analysis of the T 2 Plants:

[0262]Events 01, 04, and 10 were evaluated in greater detail in the T2 generation. Fourteen individuals were sown for each event. The transgenic plants of all 3 events showed increased height, primary inflorescence thickness, and delay of flowering time to a 0.01 level of statistical significance (Table 8). These plants also had qualitatively larger rosettes which contained more leaves (data not shown). All plants, noted in the table as ME01795-01, ME01795-04, or ME01795-10, were segregating progeny of the T1 event which we had confirmed to contain the transgene under test. All plants noted in the table as −01 Control, −04 Control, or −10 Controls were T2 segregating progeny which did not contain the transgene under test (internal controls).

[0263]One item of note in the Ty analysis is that the reduced secondary inflorescence formation observed in T1 plants is no longer present in T2 plants. In addition, the delay in flowering time appears to have increased in severity from the T1 to T2 generation.

[0264]Segregation frequencies of the transgene under test suggest that each event contains a single insert, as shown by a Chi-square test (Table 8 and data not shown).

TABLE 8
Quantitative phenotypes seen in 35S::cDNA 5662747 T2 events
Primary
Number ofHeightInflorescenceDays to
Event/ControlObservations(cm)Thickness (mm)Bolt
ME01795-01864.3*1.062*29.8*
-01 Control648.31.04824.5
ME01795-04970.9*1.065*35.8*
-04 Control542.41.04725.8
ME01795-10867.9*1.069*31.3*
-10 Control643.31.04925.3
*significantly different from control at 0.01 level, via t-test


Expression: Ceres clone 8161 is down-regulated in both the shoot apical meristem and root tips of the plant relative to whole plant mRNA extracts.

Summary of Results

[0265]The ectopic expression of cDNA 5662747 with a strong constitutive promoter (35S) results in taller plants, with thicker inflorescences, a larger rosette, and more rosette leaves. cDNA 5662747 is normally regulated in shoot and root apices, suggesting that the encoded protein may help to regulate meristem function. The increase in plant size seen by this expression is accompanied by a delay in flowering time, but no reduction in fertility. As the T1 plants had a much less severe delay in flowering than the T2 plants, but still produced the large-plant phenotype, it may be possible to use a promoter of different strength or with a different spatial expression pattern with the cDNA to maintain an increase in plant height and stem/inflorescence thickness without any increase in flowering time. Alternatively, it might be possible to co-express an early flowering gene (e.g., LEAFY) to thereby alleviate/counter balance any late flowering effects. In addition, the gene of the invention (cDNA 5662747) can be utilize to transform a plant line known to have an early flowering characteristic, to thereby create a transformed line with normal flowering time. It may also be a useful gene to increase root growth, given the similar expression pattern in shoot meristems and root tip cells.

[0266]Assuming conservation of process controlling vegetative growth across species, this gene and protein is likely to function similarly in other species. Increased vegetative biomass should give an improved source:sink ratio and improved fixation of carbon to sucrose and starch. It may in and of itself play into improved yield. Taller inflorescences give the opportunity for more flowers and therefore more seeds. The combination of improved biomass and inflorescence stature may give a significant improvement in yield. Thicker inflorescences may prevent against “snap” against wind, rain or drought, Biomass advantage and presumed photosynthesis advantage should be useful in corn and soybean.

[0267]Therefore this gene/protein is especially useful for controlling the number/rate of cell division in meristems without disturbing overall plant morphology. It could be developed in crops with an appropriate promoter to regulate size and growth rate of many individual organs. The use of a tissue-specific promoter may be particularly desirable. For example, if an increase of leaf size is desired without an increase in root size, the coding sequences of the invention can be operably linked to a leaf specific promoter for this purpose. Alternatively, if an increase in plant size is desired with no change in flowering time, the coding sequences of the invention can be modulated with a leaf specific promoter that does not direct expression in the floral meristem.

Microarray Analysis

[0268]A major way that a cell controls its response to internal or external stimuli is by regulating the rate of transcription of specific genes. For example, the differentiation of cells during organogenensis into forms characteristic of the organ is associated with the selective activation and repression of large numbers of genes. Thus, specific organs, tissues and cells are functionally distinct due to the different populations of mRNAs and protein products they possess. Internal signals program the selective activation and repression programs. For example, internally synthesized hormones produce such signals. The level of hormone can be raised by increasing the level of transcription of genes encoding proteins concerned with hormone synthesis.

[0269]To measure how a cell reacts to internal and/or external stimuli, individual mRNA levels can be measured and used as an indicator for the extent of transcription of the gene, Cells can be exposed to a stimulus, and mRNA can be isolated and assayed at different time points after stimulation. The mRNA from the stimulated cells can be compared to control cells that were not stimulated. The mRNA levels that are higher in the stimulated cell versus the control indicate a stimulus-specific response of the cell. The same is true of mRNA levels that are lower in stimulated cells versus the control condition.

[0270]Similar studies can be performed with cells taken from an organism with a defined mutation in their genome as compared with cells without the mutation. Altered mRNA levels in the mutated cells indicate how the mutation causes transcriptional changes. These transcriptional'changes are associated with the phenotype that the mutated cells exhibit that is different from the phenotype exhibited by the control cells.

[0271]Applicants have utilized microarray techniques to measure the levels of mRNAs in cells from plants transformed with the polynucleotides of the invention. In general, transformants with the genes of the invention were grown to an appropriate stage, and tissue samples were prepared for the microarray differential expression analysis.

Microarray Experimental Procedures and Results

Procedures

[0272]A summary of the parameters utilized for each of the differential expression analysis experiments is provided in TABLE 9.

1. Sample Tissue Preparation

[0273]Tissue samples for each of the expression analysis experiments were prepared as follows:

[0274](a) Roots

[0275]Seeds of Arabidopsis thaliana (Ws) were sterilized in full strength bleach for less than 5 min., washed more than 3 times in sterile distilled deionized water and plated on MS agar plates. The plates were placed at 4° C. for 3 nights and then placed vertically into a growth chamber having 16 hr light/8 hr dark cycles, 23° C., 70% relative humidity and ˜11,000 LUX. After 2 weeks, the roots were cut from the agar, flash frozen in liquid nitrogen and stored at −80° C.

[0276](b) Rosette Leaves, Stems, and Siliques

[0277]Arabidopsis thaliana (Ws) seed was vernalized at 4° C. for 3 days before sowing in Metro-mix soil type 350. Flats were placed in a growth chamber having 16 hr light/8 hr dark, 80% relative humidity, 23° C. and 13,000 LUX for germination and growth. After 3 weeks, rosette leaves, stems, and siliques were harvested, flash frozen in liquid nitrogen and stored at −80° C. until use. After 4 weeks, siliques (<5 mm, 5-10 mm and >10 mm) were harvested, flash frozen in liquid nitrogen and stored at −80° C. until use. 5 week old whole plants (used as controls) were harvested, flash frozen in liquid nitrogen and kept at −80° C. until RNA was isolated.

[0278](c) Germination

[0279]Arabidopsis thaliana seeds (ecotype Ws) were sterilized in bleach and rinsed with sterile water. The seeds were placed in 100 mm petri plates containing soaked autoclaved filter paper. Plates were foil-wrapped and left at 4° C. for 3 nights to vernalize. After cold treatment, the foil was removed and plates were placed into a growth chamber having 16 hr light/8 hr dark cycles, 23° C., 70% relative humidity and ˜11,000 lux. Seeds were collected 1 d, 2 d, 3 d and 4 d later, flash frozen in liquid nitrogen and stored at −80° C. until RNA was isolated.

[0280](d) Abscissic Acid (ABA)

[0281]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in trays and left at 4° C. for 4 days to vernalize. They were then transferred to a growth chamber having grown 16 hr light/8 hr dark, 13,000 LUX, 70% humidity, and 20° C. and watered twice a week with 1 L of 1× Hoagland's solution. Approximately 1,000 14 day old plants were spayed with 200-250 Mk of 100 μM ABA in a 0.02% solution of the detergent Silwet L-77. Whole seedlings, including roots, were harvested within a 15 to 20 minute time period at 1 hr and 6 hr after treatment, flash-frozen in liquid nitrogen and stored at −80° C.

[0282]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 100 μM ABA for treatment. Control plants were treated with water. After 6 hr and 24 hr, aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0283](e) Brassinosteroid Responsive

[0284]Two separate experiments were performed, one with epi-brassinolide and one with the brassinosteroid biosynthetic inhibitor brassinazole. In the epi-brassinolide experiments, seeds of wild-type Arabidopsis thaliana (ecotype Wassilewskija) and the brassinosteroid biosynthetic mutant dwf4-1 were sown in trays and left at 4° C. for 4 days to vernalize. They were then transferred to a growth chamber having 16 hr light/8 hr dark, 11,000 LUX, 70% humidity and 22° C. temperature. Four week old plants were spayed with a 1 μM solution of epi-brassinolide and shoot parts (unopened floral primordia and shoot apical meristems) harvested three hours later. Tissue was flash-frozen in liquid nitrogen and stored at −80° C. In the brassinazole experiments, seeds of wild-type Arabidopsis thaliana (ecotype Wassilewskija) were grown as described above. Four week old plants were spayed with a 1 μM solution of brassinazole and shoot parts (unopened floral primordia and shoot apical meristems) harvested three hours later. Tissue was flash-frozen in liquid nitrogen and stored at −80° C.

[0285]In addition to the spray experiments, tissue was prepared from two different mutants; (1) a dwf4-1 knock out mutant and (2) a mutant overexpressing the dwf4-1 gene.

[0286]Seeds of wild-type Arabidopsis thaliana (ecotype Wassilewskija) and of the dwf4-1 knock out and overexpressor mutants were sown in trays and left at 4° C. for 4 days to vernalize. They were then transferred to a growth chamber having 16 hr light/8 hr dark, 11,000 LUX, 70% humidity and 22° C. temperature. Tissue from shoot parts (unopened floral primordia and shoot apical meristems) was flash-frozen in liquid nitrogen and stored at −80° C.

[0287]Another experiment was completed with seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in trays and left at 4° C. for 4 days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr. dark) conditions, 13,000 LUX light intensity, 70% humidity, 20° C. temperature and watered twice a week with 1 L 1× Hoagland's solution (recipe recited in Feldmann et al., (1987) Mol. Gen. Genet, 208: 1-9 and described as complete nutrient solution). Approximately 1,000 14 day old plants were spayed with 200-250 mls of 0.1 μM Epi-Brassinolite in 0.02% solution of the detergent Silwet L-77. At 1 hr. and 6 hrs, after treatment aerial tissues were harvested within a 15 to 20 minute time period and flash-frozen in liquid nitrogen.

[0288]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX, Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 0.1 μM epi-brassinolide for treatment. Control plants were treated with distilled deionized water. After 24 hr, aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0289](f) Nitrogen: High to Low

[0290]Wild type Arabidopsis thaliana seeds (ecotpye Ws) were surface sterilized with 30% Clorox, 0.1% Triton X-100 for 5 minutes. Seeds were then rinsed with 4-5 exchanges of sterile double distilled deionized water. Seeds were vernalized at 4° C. for 2-4 days in darkness. After cold treatment, seeds were plated on modified 1× MS media (without NH4NO3 or KNO3), 0.5% sucrose, 0.5 g/L MES pH5.7, 1% phytagar and supplemented with KNO3 to a final concentration of 60 mM (high nitrate modified 1× MS media). Plates were then grown for 7 days in a Percival growth chamber at 22° C. with 16 hr. light/8 hr dark.

[0291]Germinated seedlings were then transferred to a sterile flask containing 50 mL of high nitrate modified 1×MS liquid media. Seedlings were grown with mild shaking for 3 additional days at 22° C. in 16 hr. light/8 hr dark (in a Percival growth chamber) on the high nitrate modified 1× MS liquid media.

[0292]After three days of growth on high nitrate modified 1×MS liquid media, seedlings were transferred either to a new sterile flask containing 50 mL of high nitrate modified 1× MS liquid media or to low nitrate modified 1× MS liquid media (containing 20 □M KNO3). Seedlings were grown in these media conditions with mild shaking at 22° C. in 16 hr light/8 hr dark for the appropriate time points and whole seedlings harvested for total RNA isolation via the Trizol method (LifeTech.). The time points used for the microarray experiments were 10 min. and 1 hour time points for both the high and low nitrate modified 1×MS media.

[0293]Alternatively, seeds that were surface sterilized in 30% bleach containing 0.1% Triton X-100 and further rinsed in sterile water, were planted on MS agar, (0.5% sucrose) plates containing 50 mM KNO3 (potassium nitrate). The seedlings were grown under constant light (3500 LUX) at 22° C. After 12 days, seedlings were transferred to MS agar plates containing either 1 mM KNO3 or 50 mM KNO3. Seedlings transferred to agar plates containing 50 mM KNO3 were treated as controls in the experiment. Seedlings transferred to plates with 1 mM KNO3 were rinsed thoroughly with sterile MS solution containing 1 mM KNO3. There were ten plates per transfer. Root tissue was collected and frozen in 15 mL Falcon tubes at various time points which included 1 hour, 2 hours, 3 hours, 4 hours, 6 hours, 9 hours, 12 hours, 16 hours, and 24 hours.

[0294]Maize 35A19 Pioneer hybrid seeds were sown on flats containing sand and grown in a Conviron growth chamber at 25° C., 16 hr light/8 hr dark, 13,000 LUX and 80% relative humidity. Plants were watered every three days with double distilled deionized water. Germinated seedlings are allowed to grow for 10 days and were watered with high nitrate modified 1× MS liquid media (see above). On day 11, young corn seedlings were removed from the sand (with their roots intact) and rinsed briefly in high nitrate modified 1×MS liquid media. The equivalent of half a flat of seedlings were then submerged (up to their roots) in a beaker containing either 500 mL of high or low nitrate modified 1×MS liquid media (see above for details).

[0295]At appropriate time points, seedlings were removed from their respective liquid media, the roots separated from the shoots and each tissue type flash frozen in liquid nitrogen and stored at −80° C. This was repeated for each time point. Total RNA was isolated using the Trizol method (see above) with root tissues only.

[0296]Corn root tissues isolated at the 4 hr and 16 hr time points were used for the microarray experiments. Both the high and low nitrate modified 1×MS media were used.

[0297](g) Nitrogen: Low to High

[0298]Arabidopsis thaliana ecotype Ws seeds were sown on flats containing 4 L of a 1:2 mixture of Grace Zonolite vermiculite and soil. Flats were watered with 3 L of water and vernalized at 4° C. for five days. Flats were placed in a Conviron growth chamber having 16 hr light/8 hr dark at 20° C., 80% humidity and 17,450 LUX. Flats were watered with approximately 1.5 L of water every four days. Mature, bolting plants (24 days after germination) were bottom treated with 2 L of either a control (100 mM mannitol pH 5.5) or an experimental (50 mM ammonium nitrate, pH 5.5) solution, Roots, leaves and siliques were harvested separately 30, 120 and 240 minutes after treatment, flash frozen in liquid nitrogen and stored at −80° C.

[0299]Hybrid maize seed (Pioneer hybrid 35A19) were aerated overnight in deionized water. Thirty seeds were plated in each flat, which contained 4 liters of Grace zonolite vermiculite. Two liters of water were bottom fed and flats were kept in a Conviron growth chamber with 16 hr light/8 hr dark at 20° C. and 80% humidity. Flats were watered with 1 L of tap water every three days. Five day old seedlings were treated as described above with 2 L of either a control (100 mM mannitol pH 6.5) solution or 1 L of an experimental (50 mM ammonium nitrate, pH 6.8) solution. Fifteen shoots per time point per treatment were harvested 10, 90 and 180 minutes after treatment, flash frozen in liquid nitrogen and stored at −80° C.

[0300]Alternatively, seeds of Arabidopsis thaliana (ecotype Wassilewskija) were left at 4° C. for 3 days to vernalize. They were then sown on vermiculite in a growth chamber having 16 hours light/8 hours dark, 12,000-14,000 LUX, 70% humidity, and 20° C. They were bottom-watered with tap water, twice weekly. Twenty-four days old plants were sprayed with either water (control) or 0.6% ammonium nitrate at 4 μL/cm2 of tray surface. Total shoots and some primary roots were cleaned of vermiculite, flash-frozen in liquid nitrogen and stored at −80° C.

[0301](h) Methyl Jasmonate

[0302]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in trays and left at 4° C. for 4 days to vernalize before being transferred to a growth chamber having 16 hr light/8 hr. dark, 13,000 LUX, 70% humidity, 20° C. temperature and watered twice a week with 1 L of a 1× Hoagland's solution. Approximately 1,000 14 day old plants were spayed with 200-250 mls of 0.001% methyl jasmonate in a 0.02% solution of the detergent Silwet L-77. At 1 hr and 6 hrs after treatment, whole seedlings, including roots, were harvested within a 15 to 20 minute time period, flash-frozen in liquid nitrogen and stored at −80° C.

[0303]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 0.001% methyl jasmonate for treatment. Control plants were treated with water. After 24 hr, aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0304](i) Salicylic Acid

[0305]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in trays and left at 4° C. for 4 days to vernalize before being transferred to a growth chamber having 16 hr light/8 hr. dark, 13,000 LUX, 70% humidity, 20° C. temperature and watered twice a week with 1 L of a 1× Hoagland's solution. Approximately 1,000 14 day old plants were spayed with 200-250 mls of 5 mM salicylic acid (solubilized in 70% ethanol) in a 0.02% solution of the detergent Silwet L-77. At 1 hr and 6 hrs after treatment, whole seedlings, including roots, were harvested within a 15 to 20 minute time period flash-frozen in liquid nitrogen and stored at −80° C.

[0306]Alternatively, seeds of wild-type Arabidopsis thaliana (ecotype Columbia) and mutant CS3726 were sown in soil type 200 mixed with osmocote fertilizer and Marathon insecticide and left at 4° C. for 3 days to vernalize. Flats were incubated at room temperature with continuous light. Sixteen days post germination plants were sprayed with 2 mM SA, 0.02% SilwettL-77 or control solution (0.02% SilwettL-77. Aerial parts or flowers were harvested 1 hr, 4 hr, 6 hr, 24 hr and 3 weeks post-treatment flash frozen and stored at −80° C.

[0307]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 2 mM SA for treatment. Control plants were treated with water. After 12 hr and 24 hr, aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0308](j) Drought Stress

[0309]Seeds of Arabidopsis thaliana (Wassilewskija) were sown in pots and left at 4° C. for three days to vernalize before being transferred to a growth chamber having 16 hr light/8 hr dark, 150,000-160,000 LUX, 20° C. and 70% humidity. After 14 days, aerial tissues were cut and left to dry on 3mM Whatman paper in a petri-plate for 1 hour and 6 hours. Aerial tissues exposed for 1 hour and 6 hours to 3 mM Whatman paper wetted with 1× Hoagland's solution served as controls. Tissues were harvested, flash-frozen in liquid nitrogen and stored at −80° C.

[0310]Alternatively, Arabidopsis thaliana (Ws) seed was vernalized at 4° C. for 3 days before sowing in Metromix soil type 350. Flats were placed in a growth chamber with 23° C., 16 hr light/8 hr. dark, 80% relative humidity, ˜13,000 LUX for germination and growth. Plants were watered with 1-1.5 L of water every four days. Watering was stopped 16 days after germination for the treated samples, but continued for the control samples. Rosette leaves and stems, flowers and siliques were harvested 2 d, 3 d, 4 d, 5 d, 6 d and 7 d after watering was stopped. Tissue was flash frozen in liquid nitrogen and kept at −80° C. until RNA was isolated. Flowers and siliques were also harvested on day 8 from plants that had undergone a 7 d drought treatment followed by 1 day of watering. Control plants (whole plants) were harvested after 5 weeks, flash frozen in liquid nitrogen and stored as above.

[0311]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX, Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in empty 1-liter beakers at room temperature for treatment. Control plants were placed in water. After 1 hr, 6 hr, 12 hr and 24 hr aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0312](k) Osmotic Stress

[0313]Seeds of Arabidopsis thaliana (Wassilewskija) were sown in trays and left at 4° C. for three days to vernalize before being transferred to a growth chamber having 16 hr light/8 hr dark, 12,000-14,000 LUX, 20° C., and 70% humidity. After 14 days, the aerial tissues were cut and placed on 3 MM Whatman paper in a petri-plate wetted with 20% PEG (polyethylene glycol-Mr 8,000) in 1× Hoagland's solution. Aerial tissues on 3 MM Whatman paper containing 1× Hoagland's solution alone served as the control. Aerial tissues were harvested at 1 hour and 6 hours after treatment, flash-frozen in liquid nitrogen and stored at −80° C.

[0314]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX, Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 10% PEG (polyethylene glycol-Mr 8,000) for treatment. Control plants were treated with water. After 1 hr and 6 hr aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0315]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers with 150 mM NaCl for treatment. Control plants were treated with water. After 1 hr, 6 hr, and 24 hr aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0316](l) Heat Shock Treatment

[0317]Seeds of Arabidopsis Thaliana (Wassilewskija) were sown in trays and left at 4° C. for three days to vernalize before being transferred to a growth chamber with 16 hr light/8 hr dark, 12,000-14,000 Lux, 70% humidity and 20° C., fourteen day old plants were transferred to a 42° C. growth chamber and aerial tissues were harvested 1 hr and 6 hr after transfer. Control plants were left at 20° C. and aerial tissues were harvested, Tissues were flash-frozen in liquid nitrogen and stored at −80° C.

[0318]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers containing 42° C. water for treatment. Control plants were treated with water at 25° C. After 1 hr and 6 hr aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0319](m) Cold Shock Treatment

[0320]Seeds of Arabidopsis thaliana (Wassilewskija) were sown in trays and left at 4° C. for three days to vernalize before being transferred to a growth chamber having 16 hr light/8 hr dark, 12,000-14,000 LUX, 20° C. and 70% humidity. Fourteen day old plants were transferred to a 4° C. dark growth chamber and aerial tissues were harvested 1 hour and 6 hours later. Control plants were maintained at 20° C. and covered with foil to avoid exposure to light. Tissues were flash-frozen in liquid nitrogen and stored at −80° C.

[0321]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 7 days. Seedlings were carefully removed from the sand and placed in 1-liter beakers containing 4° C. water for treatment. Control plants were treated with water at 25° C. After 1 hr and 6 hr aerial and root tissues were separated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0322](n) Arabidopsis Seeds

[0323]Fruits (pod+seed) 0-5 mm

[0324]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage, Siliques 0-5 mm in length containing post fertilization through pre-heart stage [0-72 hours after fertilization (HAF)] embryos were harvested and flash frozen in liquid nitrogen.

[0325]Fruits (pod+seed) 5-10 mm

[0326]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Siliques 5-10 mm in length containing heart-through early upturned-U-stage [72-120 hours after fertilization (HAF)] embryos were harvested and flash frozen in liquid nitrogen.

[0327]Fruits (pod+seed)>10 mm

[0328]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Siliques >10 mm in length containing green, late upturned-U-stage [>120 hours after fertilization (HAF)−9 days after flowering (DAF)] embryos were harvested and flash frozen in liquid nitrogen.

[0329]Green Pods 5-10 mm (Control Tissue for Samples 72-74)

[0330]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Green siliques 5-10 mm in length containing developing seeds 72-120 hours after fertilization (HAF)] were opened and the seeds removed. The remaining tissues (green pods minus seed) were harvested and flash frozen in liquid nitrogen.

[0331]Green Seeds from Fruits >10 mm

[0332]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Green siliques >10 mm in length containing developing seeds up to 9 days after flowering (DAF)] were opened and the seeds removed and harvested and flash frozen in liquid nitrogen.

[0333]Brown Seeds from Fruits >10 mm

[0334]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Yellowing siliques >10 mm in length containing brown, dessicating seeds >11 days after flowering (DAF)] were opened and the seeds removed and harvested and flash frozen in liquid nitrogen.

[0335]Green/Brown Seeds from Fruits >10 mm

[0336]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature. 3-4 siliques (fruits) bearing developing seeds were selected from at least 3 plants and were hand-dissected to determine what developmental stage(s) were represented by the enclosed embryos. Description of the stages of Arabidopsis embryogenesis used in this determination were summarized by Bowman (1994). Silique lengths were then determined and used as an approximate determinant for embryonic stage. Green siliques >10 mm in length containing both green and brown seeds >9 days after flowering (DAF)] were opened and the seeds removed and harvested and flash frozen in liquid nitrogen.

[0337]Mature Seeds (24 Hours after Imbibition)

[0338]Mature dry seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown onto moistened filter paper and left at 4° C. for two to three days to vernalize. Imbibed seeds were then transferred to a growth chamber [16 hr light: 8 hr dark conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature], the emerging seedlings harvested after 48 hours and flash frozen in liquid nitrogen.

[0339]Mature Seeds (Dry)

[0340]Seeds of Arabidopsis thaliana (ecotype Wassilewskija) were sown in pots and left at 4° C. for two to three days to vernalize. They were then transferred to a growth chamber. Plants were grown under long-day (16 hr light: 8 hr dark) conditions, 7000-8000 LUX light intensity, 70% humidity, and 22° C. temperature and taken to maturity. Mature dry seeds are collected, dried for one week at 28° C., and vernalized for one week at 4° C. before used as a source of RNA.

[0341](o) Herbicide Treatment

[0342]Arabidopsis thaliana (Ws) seeds were sterilized for 5 min. with 30% bleach, 50 μl Triton in a total volume of 50 ml. Seeds were vernalized at 4° C. for 3 days before being plated onto GM agar plates at a density of about 144 seeds per plate. Plates were incubated in a Percival growth chamber having 16 hr light/8 hr dark, 80% relative humidity, 22° C. and 11,000 LUX for 14 days.

[0343]Plates were sprayed (˜0.5 mls/plate) with water, Finale (1.128 g/L), Glean (1.88 g/L), RoundUp (0.01 g/L) or Trimec (0.08 g/L). Tissue was collected and flash frozen in liquid nitrogen at the following time points: 0, 1, 2, 4, 8, 12 and 24 hours. Frozen tissue was stored at −80° C. prior to RNA isolation.

[0344](p) Root Tips

[0345]Seeds of Arabidopsis thaliana (ecotye Ws) were placed on MS plates and vernalized at 4° C. for 3 days before being placed in a 25° C. growth chamber having 16 hr light/8 hr dark, 70% relative humidity and about 3 W/m2. After 6 days, young seedlings were transferred to flasks containing B5 liquid medium, 1% sucrose and 0.05 mg/l indole-3-butyric acid. Flasks were incubated at room temperature with 100 rpm agitation. Media was replaced weekly. After three weeks, roots were harvested and incubated for 1 hr with 2% pectinase, 0.2% cellulase, pH 7 before straining through a #80 (Sigma) sieve. The root body material remaining on the sieve (used as the control) was flash frozen and stored at −80° C. until use. The material that passed through the #80 sieve was strained through a #200 (Sigma) sieve and the material remaining on the sieve (root tips) was flash frozen and stored at −80° C. until use. Approximately 10 mg of root tips were collected from one flask of root culture.

[0346]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. Covered flats were watered every three days for 8 days. Seedlings were carefully removed from the sand and the root tips (−2 mm long) were removed and flash frozen in liquid nitrogen prior to storage at −80° C. The tissues above the root tips (˜1 cm long) were cut, treated as above and used as control tissue.

[0347](q) Imbibed Seed

[0348]Seeds of maize hybrid 35A (Pioneer) were sown in water-moistened sand in covered flats (10 rows, 5-6 seed/row) and covered with clear, plastic lids before being placed in a growth chamber having 16 hr light (25° C.)/8 hr dark (20° C.), 75% relative humidity and 13,000-14,000 LUX. One day after sowing, whole seeds were flash frozen in liquid nitrogen prior to storage at −80° C. Two days after sowing, embryos and endosperm were isolated and flash frozen in liquid nitrogen prior to storage at −80° C. On days 3-6, aerial tissues, roots and endosperm were isolated and flash frozen in liquid nitrogen prior to storage at −80° C.

[0349](r) Flowers (Green, White or Buds)

[0350]Approximately 10 □l of Arabidopsis thaliana seeds (ecotype Ws) were sown on 350 soil (containing 0.03% marathon) and vernalized at 4 C for 3 days. Plants were then grown at room temperature under fluorescent lighting until flowering. Flowers were harvested after 28 days in three different categories. Buds that had not opened at all and were completely green were categorized as “flower buds” (also referred to as green buds by the investigator). Buds that had started to open, with white petals emerging slightly were categorized as “green flowers” (also referred to as white buds by the investigator). Flowers that had opened mostly (with no silique elongation) with white petals completely visible were categorized as “white flowers” (also referred to as open flowers by the investigator). Buds and flowers were harvested with forceps, flash frozen in liquid nitrogen and stored at −80 C until RNA was isolated.

2. Microarray Hybridization Procedures

[0351]Microarray technology provides the ability to monitor mRNA transcript levels of thousands of genes in a single experiment. These experiments simultaneously hybridize two differentially labeled fluorescent cDNA pools to glass slides that have been previously spotted with cDNA clones of the same species. Each arrayed cDNA spot will have a corresponding ratio of fluorescence that represents the level of disparity between the respective mRNA species in the two sample pools. Thousands of polynucleotides can be spotted on one slide, and each experiment generates a global expression pattern.

Coating Slides

[0352]
The microarray consists of a chemically coated microscope slide, referred herein as a “chip” with numerous polynucleotide samples arrayed at a high density. The poly-L-lysine coating allows for this spotting at high density by providing a hydrophobic surface, reducing the spreading of spots of DNA solution arrayed on the slides, Glass microscope slides (Gold Seal #3010 manufactured by Gold Seal Products, Portsmouth, N.H., USA) were coated with a 0.1% W/V solution of Poly-L-lysine (Sigma, St. Louis, Mo.) using the following protocol:
  • [0353]1. Slides were placed in slide racks (Shandon Lipshaw #121). The racks were then put in chambers (Shandon Lipshaw #121).
  • [0354]2. Cleaning solution was prepared:
    • [0355]70 g NaOH was dissolved in 280 mL ddH2O.
    • [0356]420 mL 95% ethanol was added. The total volume was 700 mL (=2×350 mL); it was stirred until completely mixed. If the solution remained cloudy, ddH2O was added until clear.
  • [0357]3. The solution was poured into chambers with slides; the chambers were covered with glass lids. The solution was mixed on an orbital shaker for 2 hr.
  • [0358]4. The racks were quickly transferred to fresh chambers filled with ddH2O. They were rinsed vigorously by plunging racks up and down. Rinses were repeated 4× with fresh ddH2O each time, to remove all traces of NaOH-ethanol.
  • [0359]5. Polylysine solution was prepared:
    • [0360]0 mL poly-L-lysine+70 mL tissue culture PBS in 560 mL water, using plastic graduated cylinder and beaker.
  • [0361]6. Slides were transferred to polylysine solution and shaken for 1 hr.
  • [0362]7. The rack was transferred to a fresh chambers filled with ddH2O. It was plunged up and down 5× to rinse.
  • [0363]8. The slides were centrifuged on microtiter plate carriers (paper towels were placed below the rack to absorb liquid) for 5 min. @ 500 rpm. The slide racks were transferred to empty chambers with covers.
  • [0364]9. Slide racks were dried in a 45 C oven for 10 min.
  • [0365]10. The slides were stored in a closed plastic slide box.
  • [0366]11. Normally, the surface of lysine coated slides was not very hydrophobic immediately after this process, but became increasingly hydrophobic with storage. A hydrophobic surface helped ensure that spots didn't run together while printing at high densities. After they aged for 10 days to a month the slides were ready to use. However, coated slides that have been sitting around for long periods of time were usually too old to be used. This was because they developed opaque patches, visible when held to the light, and these resulted in high background hybridization from the fluorescent probe. Alternatively, pre-coated glass slides were purchased from TeleChem International, Inc, (Sunnyvale, Calif., 94089; catalog number SMM-25, Superamine substrates).
    PCR Amplification of cDNA Clone Inserts

[0367]Polynucleotides were amplified from Arabidopsis cDNA clones using insert specific probes. The resulting 100 uL PCR reactions were purified with Qiaquick 96 PCR purification columns (Qiagen, Valencia, Calif., USA) and eluted in 30 uL of 5 mM Tris. 8.5 uL of the elution were mixed with 1.5 uL of 20×SSC to give a final spotting solution of DNA in 3×SSC. The concentrations of DNA generated from each clone varied between 10-100 ng/ul, but were usually about 50 ng/ul.

Arraying of PCR Products on Glass Slides

[0368]PCR products from cDNA clones were spotted onto the poly-L-Lysine coated glass slides using an arrangement of quill-tip pins (ChipMaker 3 spotting pins; Telechem, International, Inc., Sunnyvale, Calif., USA) and a robotic arrayer (PixSys 3500, Cartesian Technologies, Irvine, Calif., USA). Around 0.5 nl of a prepared PCR product was spotted at each location to produce spots with approximately 100 um diameters. Spot center-to-center spacing was from 180 um to 210 um depending on the array, Printing was conducted in a chamber with relative humidity set at 50%.

[0369]Slides containing maize sequences were purchased from Agilent Technology (Palo Alto, Calif. 94304).

Post-Processing of Slides

[0370]After arraying, slides were processed through a series of steps—rehydration, UV cross-linking, blocking and denaturation—required prior to hybridization. Slides were rehydrated by placing them over a beaker of warm water (DNA face down), for 2-3 sec, to distribute the DNA more evenly within the spots, and then snap dried on a hot plate (DNA side, face up). The DNA was then cross-linked to the slides by UV irradiation (60-55 mJ; 2400 Stratalinker, Stratagene, La Jolla, Calif., USA).

[0371]Following this a blocking step was performed to modify remaining free lysine groups, and hence minimize their ability to bind labeled probe DNA. To achieve this the arrays were placed in a slide rack. An empty slide chamber was left ready on an orbital shaker. The rack was bent slightly inwards in the middle, to ensure the slides would not run into each other while shaking. The blocking solution was prepared as follows:

3×350-ml glass chambers (with metal tops) were set to one side, and a large round Pyrex dish with dH2O was placed ready in the microwave. At this time, 15 ml sodium borate was prepared in a 50 ml conical tube.

[0372]6-g succinic anhydride was dissolved in approx. 325-350 mL 1-methyl-2-pyrrolidinone. Rapid addition of reagent was crucial.

[0373]a. Immediately after the last flake of the succinic anhydride dissolved, the 15-mL sodium borate was added.

[0374]b. Immediately after the sodium borate solution mixed in, the solution was poured into an empty slide chamber.

[0375]c. The slide rack was plunged rapidly and evenly in the solution. It was vigorously shaken up and down for a few seconds, making sure slides never left the solution.

[0376]d. It was mixed on an orbital shaker for 15-20 min. Meanwhile, the water in the Pyrex dish (enough to cover slide rack) was heated to boiling.

[0377]Following this, the slide rack was gently plunge in the 95 C water (just stopped boiling) for 2 min. Then the slide rack was plunged 5×in 95% ethanol. The slides and rack were centrifuged for 5 min. @ 500 rpm. The slides were loaded quickly and evenly onto the carriers to avoid streaking. The arrays were used immediately or store in slide box.

[0378]The Hybridization process began with the isolation of mRNA from the two tissues (see “Isolation of total RNA” and “Isolation of mRNA”; below) in question followed by their conversion to single stranded cDNA (see “Generation of probes for hybridization”, below). The cDNA from each tissue was independently labeled with a different fluorescent dye and then both samples were pooled together. This final differentially labeled cDNA pool was then placed on a processed microarray and allowed to hybridize (see “Hybridization and wash conditions”, below).

Isolation of Total RNA

[0379]Approximately 1 g of plant tissue was ground in liquid nitrogen to a fine powder and transferred into a 50-ml centrifuge tube containing 10 ml of Trizol reagent. The tube was vigorously vortexed for 1 min and then incubated at room temperature for 10-20 min. on an orbital shaker at 220 rpm. Two ml of chloroform was added to the tube and the solution vortexed vigorously for at least 30-sec before again incubating at room temperature with shaking. The sample was then centrifuged at 12,000×g (10,000 rpm) for 15-20 min at 4° C. The aqueous layer was removed and mixed by inversion with 2.5 ml of 1.2 M NaCl/0.8 M Sodium Citrate and 2.5 ml of isopropyl alcohol added. After a 10 min, incubation at room temperature, the sample was centrifuged at 12,000×g (10,000 rpm) for 15 min at 4° C. The pellet was washed with 70% ethanol, re-centrifuged at 8,000 rpm for 5 min and then air dried at room temperature for 10 min. The resulting total RNA was dissolved in either TE (10 mM Tris-HCl, 1 mM EDTA, pH 8.0) or DEPC (diethylpyrocarbonate) treated deionized water (RNAse-free water). For subsequent isolation of mRNA using the Qiagen kit, the total RNA pellet was dissolved in RNAse-free water.

Isolation of mRNA

[0380]mRNA was isolated using the Qiagen Oligotex mRNA Spin-Column protocol (Qiagen, Valencia, Calif.). Briefly, 500 μl OBB buffer (20 mM Tris-Cl, pH 7.5, 1 M NaCl, 2 mM EDTA, 0.2% SDS) was added to 500 μl of total RNA (0.5-0.75 mg) and mixed thoroughly. The sample was first incubated at 70° C. for 3 min, then at room temperature for 10 minutes and finally centrifuged for 2 min at 14,000-18,000×g. The pellet was resuspended in 400 μl OW2 buffer (10 mM Tris-Cl, pH 7.5, 150 mM NaCl, 1 mM EDTA) by vortexing, the resulting solution placed on a small spin column in a 1.5 ml RNase-free microcentrifuge tube and centrifuged for 1 min at 14,000-18,000×g. The spin column was transferred to a new 1.5 ml RNase-free microcentrifuge tube and washed with 400 μl of OW2 buffer. To release the isolated mRNA from the resin, the spin column was again transferred to a new RNase-free 1.5 ml microcentrifuge tube, 20-100 μl 70° C. OEB buffer (5 mM Tris-Cl, pH 7.5) added and the resin resuspended in the resulting solution via pipeting. The mRNA solution was collected after centrifuging for 1 min at 14,000-18,000×g.

[0381]Alternatively, mRNA was isolated using the Stratagene Poly(A) Quik mRNA Isolation Kit (Startagene, La Jolla, Calif.). Here, up to 0.5 mg of total RNA (maximum volume of 1 ml) was incubated at 65° C. for 5 minutes, snap cooled on ice and 0.1× volumes of 10× sample buffer (10 mM Tris-HCl (pH 7.5), 1 mM EDTA (pH 8.0) 5 M NaCl) added. The RNA sample was applied to a prepared push column and passed through the column at a rate of ˜1 drop every 2 sec. The solution collected was reapplied to the column and collected as above. 200 μl of high salt buffer (10 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.5 NaCl) was applied to the column and passed through the column at a rate of ˜1 drop every 2 sec. This step was repeated and followed by three low salt buffer (10 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.1 M NaCl) washes preformed in a similar manner. mRNA was eluted by applying to the column four separate 200 μl aliquots of elution buffer (10 mM Tris-HCl (pH 7.5), 1 mM EDTA) preheated to 65° C. Here, the elution buffer was passed through the column at a rate of 1 drop/Sec. The resulting mRNA solution was precipitated by adding 0.1× volumes of 10× sample buffer, 2.5 volumes of ice-cold 100% ethanol, incubating overnight at −20° C. and centrifuging at 14,000-18,000×g for 20-30 min at 4° C. The pellet was washed with 70% ethanol and air dried for 10 min. at room temperature before resuspension in RNase-free deionized water.

Preparation of Yeast Controls

[0382]Plasmid DNA was isolated from the following yeast clones using Qiagen filtered maxiprep kits (Qiagen, Valencia., Calif.): YAL022c(Fun26), YAL031c(Fun21), YBRO32w, YDL131w, YDL182w, YDL194w, YDL196w, YDR050c and YDR116c. Plasmid DNA was linearized with either BsrB1 (YAL022c(Fun26), YAL031c(Fun21), YDL131w, YDL182w, YDL194w, YDL196w, YDR050c) or AflIII (YBR032w, YDR116c) and isolated.

In Vitro Transcription of Yeast Clones

[0383]The following solution was incubated at 37° C. for 2 hours: 17 μl of isolated yeast insert DNA (1 μg), 20 μl 5× buffer, 10 μl 100 mM DTT, 2.5 μl (100 U) RNasin, 20 μl 2.5 mM (ea.) rNTPs, 2.7 (40U) SP6 polymerase and 27.8 μl RNase-free deionized water. 2 μl (2 U) Ampli DNase I was added and the incubation continued for another 15 min, 10 μl 5M NH4OAC and 100 μl phenol:chloroform:isoamyl alcohol (25:24:1) were added, the solution vortexed and then centrifuged to separate the phases. To precipitate the RNA, 250 μl ethanol was added and the solution incubated at −20° C. for at least one hour. The sample was then centrifuged for 20 min at 4° C. at 14,000-18,000×g, the pellet washed with 500 μl of 70% ethanol, air dried at room temperature for 10 min and resuspended in 100 μl of RNase-free deionized water. The precipitation procedure was then repeated.

[0384]Alternatively, after the two-hour incubation, the solution was extracted with phenol/chloroform once before adding 0.1 volume 3M sodium acetate and 2.5 volumes of 100% ethanol. The solution was centrifuged at 15,000 rpm, 4° C. for 20 minutes and the pellet resuspended in RNase-free deionized water. The DNase I treatment was carried out at 37° C. for 30 minutes using 2 U of Ampli DNase I in the following reaction condition: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2. The DNase I reaction was then stopped with the addition of NH4OAC and phenol:chloroform:isoamyl alcohol (25:24:1), and RNA isolated as described above.

[0385]0.15-2.5 ng of the in vitro transcript RNA from each yeast clone were added to each plant mRNA sample prior to labeling to serve as positive (internal) probe controls.

Generation of Probes for Hybridization

[0386]Generation of Labeled Probes for Hybridization from First-Strand cDNA

[0387]Hybridization probes were generated from isolated mRNA using an Atlas™ Glass Fluorescent Labeling Kit (Clontech Laboratories, Inc., Palo Alto, Calif., USA). This entails a two step labeling procedure that first incorporates primary aliphatic amino groups during cDNA synthesis and then couples fluorescent dye to the cDNA by reaction with the amino functional groups. Briefly, 5 μg of oligo(dT)18 primer d(TTTTTTTTTTTTTTTTTTV) was mixed with Poly A+ mRNA (1.5-2 μg mRNA isolated using the Qiagen Oligotex mRNA Spin-Column protocol or the Stratagene Poly(A) Quik mRNA Isolation protocol (Stratagene, La Jolla, Calif., USA)) in a total volume of 25 μl. The sample was incubated in a thermocycler at 70° C. for 5 min, cooled to 48° C. and 10 μl of 5× cDNA Synthesis Buffer (kit supplied), 5 μl X dNTP mix (dATP, dCTP, dCTP, dTTP and aminoallyl-dUTP; kit supplied), 7.5 μl deionized water and 2.5 μl MMLV Reverse Transcriptase (500U) added. The reaction was then incubated at 48° C. for 30 minutes, followed by 1 hr incubation at 42° C. At the end of the incubation the reaction was heated to 70° C. for 10 min, cooled to 37° C. and 0.5 μl (5 U) RNase H added, before incubating for 15 min at 37° C. The solution was vortexed for 1 min after the addition of 0.5 μl 10.5 M EDTA and 5 μl of QuickClean Resin (kit supplied) then centrifuged at 14,000-18,000×g for 1 min. After removing the supernatant to a 0.45 μm spin filter (kit supplied), the sample was again centrifuged at 14,000-18,000×g for 1 min, and 5.5 μl 3 M sodium acetate and 137.5 μl of 100% ethanol added to the sample before incubating at −20° C. for at least 1 hr. The sample was then centrifuged at 14,000-18,000×g at 4° C. for 20 min, the resulting pellet washed with 500 μl 70% ethanol, air-dried at room temperature for 10 min and resuspended in 10 μl of 2× fluorescent labeling buffer (kit provided). 10 μl each of the fluorescent dyes Cy3 and Cy5 (Amersham Pharmacia (Piscataway, N.J., USA); prepared according to Atlas™ kit directions of Clontech) were added and the sample incubated in the dark at room temperature for 30 min.

[0388]The fluorescently labeled first strand cDNA was precipitated by adding 2 μl 3M sodium acetate and 50 μl 100% ethanol, incubated at −20° C. for at least 2 hrs, centrifuged at 14,000-18,000×g for 20 min, washed with 70% ethanol, air-dried for 10 min and dissolved in 100 μl of water.

[0389]Alternatively, 3-4 μg mRNA, 2.5 (˜8.9 ng of in vitro translated mRNA) μl yeast control and 3 μg oligo dTV (TTTTTTTTTTTTTTTTTT(A/C/G) were mixed in a total volume of 24.7 μl. The sample was incubated in a thermocycler at 70° C. for 10 min. before chilling on ice. To this, 8 μl of 5× first strand buffer (SuperScript II RNase H—Reverse Transcriptase kit from Invitrogen (Carlsbad, Calif. 92008); cat no, 18064022), 0.8° C. of aa-dUTP/dNTP mix (50×; 25 mM dATP, 25 mM dGTP, 25 mM dCTP, 15 mM dTTP, 10 mM aminoallyl-dUTP), 4 μl of 0.1 M DTT and 2.5 μl (500 units) of Superscript R.T.II enzyme (Stratagene) were added. The sample was incubated at 42° C. for 2 hours before a mixture of 10° C. of 1M NaOH and 10° C. of 0.5 M EDTA were added. After a 15 minute incubation at 65° C., 25 μl of 1 M Tris pH 7.4 was added. This was mixed with 450 μl of water in a Microcon 30 column before centrifugation at 11,000×g for 12 min. The column was washed twice with 450 μl (centrifugation at 11,000 g, 12 min.) before eluting the sample by inverting the Microcon column and centrifuging at 11,000×g for 20 seconds. Sample was dehydrated by centrifugation under vacuum and stored at −20° C.

[0390]Each reaction pellet was dissolved in 9 μl of 0.1 M carbonate buffer (0.1M sodium carbonate and sodium bicarbonate, pH=8.5-9) and 4.5 μl of this placed in two microfuge tubes. 4.5 μl of each dye (in DMSO) were added and the mixture incubated in the dark for 1 hour. 4.5 μl of 4 M hydroxylamine was added and again incubated in the dark for 15 minutes.

[0391]Regardless of the method used for probe generation, the probe was purified using a Qiagen PCR cleanup kit (Qiagen, Valencia, Calif., USA), and eluted with 100 ul ED (kit provided). The sample was loaded on a Microcon YM-30 (Millipore, Bedford, Mass., USA) spin column and concentrated to 4-5 ul in volume.

[0392]Probes for the maize microarrays were generated using the Fluorescent Linear Amplification Kit (cat. No. G2556A) from Agilent Technologies (Palo Alto, Calif.).

Hybridization and Wash Conditions

[0393]The following Hybridization and Washing Condition were developed:

Hybridization Conditions:

[0394]Labeled probe was heated at 95° C. for 3 min and chilled on ice. Then 25 □L of the hybridization buffer which was warmed at 42 C was added to the probe, mixing by pipeting, to give a final concentration of:

50% formamide

[0395]4×SSC

[0396]0.03% SDS

5×Denhardt's solution
0.1 μg/ml single-stranded salmon sperm DNA

[0397]The probe was kept at 42 C. Prior to the hybridization, the probe was heated for 1 more min., added to the array, and then covered with a glass cover slip. Slides were placed in hybridization chambers (Telechem, Sunnyvale, Calif.) and incubated at 42° C. overnight.

Washing Conditions:

  • [0398]A. Slides were washed in 1×SSC 0.03% SDS solution at room temperature for 5 minutes,
  • [0399]B. Slides were washed in 0.2×SSC at room temperature for 5 minutes,
  • [0400]C. Slides were washed in 0.05×SSC at room temperature for 5 minutes.

[0401]After A, B, and C, slides were spun at 800×g for 2 min, to dry. They were then scanned.

[0402]Maize microarrays were hybridized according to the instructions included Fluorescent Linear Amplification Kit (cat. No. 02556A) from Agilent Technologies (Palo Alto, Calif.).

Scanning of Slides

[0403]The chips were scanned using a ScanArray 3000 or 5000 (General Scanning, Watertown, Mass., USA). The chips were scanned at 543 and 633 nm, at 10 um resolution to measure the intensity of the two fluorescent dyes incorporated into the samples hybridized to the chips.

Data Extraction and Analysis

[0404]The images generated by scanning slides consisted of two 16-bit TIFF images representing the fluorescent emissions of the two samples at each arrayed spot. These images were then quantified and processed for expression analysis using the data extraction software Imagene (Biodiscovery, Los Angeles, Calif., USA). Imagene output was subsequently analyzed using the analysis program Genespring (Silicon Genetics, San Carlos, Calif., USA). In Genespring, the data was imported using median pixel intensity measurements derived from Imagene output. Background subtraction, ratio calculation and normalization were all conducted in Genespring. Normalization was achieved by breaking the data in to 32 groups, each of which represented one of the 32 pin printing regions on the microarray. Groups consist of 360 to 550 spots. Each group was independently normalized by setting the median of ratios to one and multiplying ratios by the appropriate factor.

Results

[0405]The MA_diff Table (TABLE 10) presents the results of the differential expression experiments for the mRNAs, as reported by their corresponding cDNA ID number, that were differentially transcribed under a particular set of conditions as compared to a control sample. The cDNA ID numbers correspond to those utilized in the Reference and Sequence Tables. Increases in mRNA abundance levels in experimental plants versus the controls are denoted with the plus sign (+). Likewise, reductions in mRNA abundance levels in the experimental plants are denoted with the minus (−) sign.

[0406]The Table is organized according to the clone number with each set of experimental conditions being denoted by the term “Expt Rep ID:” followed by a “short name”. Table 9 links each Expt Rep ID with a short description of the experiment and the parameters. The experiment numbers are referenced in the appropriate utility/functions sections herein.

[0407]The sequences showing differential expression in a particular experiment (denoted by either a “+” or “−” in the Table) thereby shows utility for a function in a plant, and these functions/utilities are described in detail below, where the title of each section (i.e. a “utility section”) is correlated with the particular differential expression experiment in TABLE 9.

Organ-Affecting Genes, Gene Components, Products (Including Differentiation and Function)

Root Genes

[0408]The economic values of roots arise not only from harvested adventitious roots or tubers, but also from the ability of roots to funnel nutrients to support growth of all plants and increase their vegetative material, seeds, fruits, etc. Roots have four main functions. First, they anchor the plant in the soil. Second, they facilitate and regulate the molecular signals and molecular traffic between the plant, soil, and soil fauna. Third, the root provides a plant with nutrients gained from the soil or growth medium. Fourth, they condition local soil chemical and physical properties.

[0409]Root genes are active or potentially active to a greater extent in roots than in most other organs of the plant. These genes and gene products can regulate many plant traits from yield to stress tolerance. Root genes can be used to modulate root growth and development.

[0410]Differential Expression of the Sequences in Roots

[0411]The relative levels of mRNA product in the root versus the aerial portion of the plant was measured. Specifically, mRNA was isolated from roots and root tips of Arabidopsis plants and compared to mRNA isolated from the aerial portion of the plants utilizing microarray procedures. Results are presented in TABLE 10.

Reproduction Genes, Gene Components and Products

[0412]Reproduction genes are defined as genes or components of genes capable of modulating any aspect of sexual reproduction from flowering time and inflorescence development to fertilization and finally seed and fruit development. These genes are of great economic interest as well as biological importance. The fruit and vegeTable industry grosses over $1 billion USD a year. The seed market, valued at approximately $15 billion USD annually, is even more lucrative.

Inflorescence and Floral Development Genes, Gene Components and Products

[0413]During reproductive growth the plant enters a program of floral development that culminates in fertilization, followed by the production of seeds. Senescence may or may not follow. The flower formation is a precondition for the sexual propagation of plants and is therefore essential for the propagation of plants that cannot be propagated vegetatively as well as for the formation of seeds and fruits. The point of time at which the merely vegetative growth of plants changes into flower formation is of vital importance for example in agriculture, horticulture and plant breeding. Also the number of flowers is often of economic importance, for example in the case of various useful plants (tomato, cucumber, zucchini, cotton etc.) with which an increased number of flowers may lead to an increased yield, or in the case of growing ornamental plants and cut flowers.

[0414]Flowering plants exhibit one of two types of inflorescence architecture: indeterminate, in which the inflorescence grows indefinitely, or determinate, in which a terminal flower is produced. Adult organs of flowering plants develop from groups of stem cells called meristems. The identity of a meristem is inferred from structures it produces: vegetative meristems give rise to roots and leaves, inflorescence meristems give rise to flower meristems, and flower meristems give rise to floral organs such as sepals and petals. Not only are meristems capable of generating new meristems of different identity, but their own identity can change during development. For example, a vegetative shoot meristem can be transformed into an inflorescence meristem upon floral induction, and in some species, the inflorescence meristem itself will eventually become a flower meristem. Despite the importance of meristem transitions in plant development, little is known about the underlying mechanisms.

[0415]Following germination, the shoot meristem produces a series of leaf meristems on its flanks. However, once floral induction has occurred, the shoot meristem switches to the production of flower meristems. Flower meristems produce floral organ primordia, which develop individually into sepals, petals, stamens or carpels. Thus, flower formation can be thought of as a series of distinct developmental steps, i.e. floral induction, the formation of flower primordia and the production of flower organs. Mutations disrupting each of the steps have been isolated in a variety of species, suggesting that a genetic hierarchy directs the flowering process (see for review, Weigel and Meyerowitz, In Molecular Basis of Morphogenesis (ed. M. Bernfield). 51st Annual Symposium of the Society for Developmental Biology, pp. 93-107, New York, 1993).

[0416]Expression of many reproduction genes and gene products is orchestrated by internal programs or the surrounding environment of a plant. These genes can be used to modulate traits such as fruit and seed yield

Seed and Fruit Development Genes, Gene Components and Products

[0417]The ovule is the primary female sexual reproductive organ of flowering plants. At maturity it contains the egg cell and one large central cell containing two polar nuclei encased by two integuments that, after fertilization, develops into the embryo, endosperm, and seed coat of the mature seed, respectively. As the ovule develops into the seed, the ovary matures into the fruit or silique. As such, seed and fruit development requires the orchestrated transcription of numerous polynucleotides, some of which are ubiquitous, others that are embryo-specific and still others that are expressed only in the endosperm, seed coat, or fruit. Such genes are termed fruit development responsive genes and can be used to modulate seed and fruit growth and development such as seed size, seed yield, seed composition and seed dormancy.

[0418]Differential Expression of the Sequences in Siliques, Inflorescences and Flowers

The relative levels of mRNA product in the siliques relative to the plant as a whole was measured. The results are presented in TABLE 10.

[0419]Differential Expression of the Sequences in Hybrid Seed Development

[0420]The levels of mRNA product in the seeds relative to those in a leaf and floral stems was measured. The results are presented TABLE 10,

Development Genes, Gene Components and Products

Imbibition and Germination Responsive Genes, Gene Components and Products

[0421]Seeds are a vital component of the world's diet. Cereal grains alone, which comprise ˜90% of all cultivated seeds, contribute up to half of the global per capita energy intake. The primary organ system for seed production in flowering plants is the ovule. At maturity, the ovule consists of a haploid female gametophyte or embryo sac surrounded by several layers of maternal tissue including the nucleus and the integuments. The embryo sac typically contains seven cells including the egg cell, two synergids, a large central cell containing two polar nuclei, and three antipodal cells. That pollination results in the fertilization of both egg and central cell. The fertilized egg develops into the embryo. The fertilized central cell develops into the endosperm. And the integuments mature into the seed coat. As the ovule develops into the seed, the ovary matures into the fruit or silique. Late in development, the developing seed ends a period of extensive biosynthetic and cellular activity and begins to desiccate to complete its development and enter a dormant, metabolically quiescent state. Seed dormancy is generally an undesirable characteristic in agricultural crops, where rapid germination and growth are required. However, some degree of dormancy is advantageous, at least during seed development. This is particularly true for cereal crops because it prevents germination of grains while still on the ear of the parent plant (preharvest sprouting), a phenomenon that results in major losses to the agricultural industry. Extensive domestication and breeding of crop species have ostensibly reduced the level of dormancy mechanisms present in the seeds of their wild ancestors, although under some adverse environmental conditions, dormancy may reappear. By contrast, weed seeds frequently mature with inherent dormancy mechanisms that allow some seeds to persist in the soil for many years before completing germination.

[0422]Germination commences with imbibition, the uptake of water by the dry seed, and the activation of the quiescent embryo and endosperm. The result is a burst of intense metabolic activity. At the cellular level, the genome is transformed from an inactive state to one of intense transcriptional activity. Stored lipids, carbohydrates and proteins are catabolized fueling seedling growth and development. DNA and organelles are repaired, replicated and begin functioning. Cell expansion and cell division are triggered. The shoot and root apical meristem are activated and begin growth and organogenesis. Schematic 4 summarizes some of the metabolic and cellular processes that occur during imbibition. Germination is complete when a part of the embryo, the radicle, extends to penetrate the structures that surround it. In Arabidopsis, seed germination takes place within twenty-four (24) hours after imbibition, As such, germination requires the rapid and orchestrated transcription of numerous polynucleotides. Germination is followed by expansion of the hypocotyl and opening of the cotyledons. Meristem development continues to promote root growth and shoot growth, which is followed by early leaf formation.

Imbibition and Germination Genes

[0423]Imbibition and germination includes those events that commence with the uptake of water by the quiescent dry seed and terminate with the expansion and elongation of the shoots and roots. The germination period exists from imbibition to when part of the embryo, usually the radicle, extends to penetrate the seed coat that surrounds it. Imbibition and germination genes are defined as genes, gene components and products capable of modulating one or more processes of imbibition and germination described above. They are useful to modulate many plant traits from early vigor to yield to stress tolerance.

[0424]Differential Expression of the Sequences in Germinating Seeds and Imbibed Embryos

[0425]The levels of mRNA product in the seeds versus the plant as a whole was measured. The results are presented in TABLE 10.

Hormone Responsive Genes, Gene Components and Products

Abscissic Acid Responsive Genes, Gene Components and Products

[0426]Plant hormones are naturally occurring substances, effective in very small amounts, which act as signals to stimulate or inhibit growth or regulate developmental processes in plants. Abscisic acid (ABA) is a ubiquitous hormone in vascular plants that has been detected in every major organ or living tissue from the root to the apical bud. The major physiological responses affected by ABA are dormancy, stress stomatal closure, water uptake, abscission and senescence. In contrast to Auxins, cytokinins and gibberellins, which are principally growth promoters, ABA primarily acts as an inhibitor of growth and metabolic processes.

[0427]Changes in ABA concentration internally or in the surrounding environment in contact with a plant results in modulation of many genes and gene products. These genes and/or products are responsible for effects on traits such as plant vigor and seed yield.

While ABA responsive polynucleotides and gene products can act alone, combinations of these polynucleotides also affect growth and development. Useful combinations include different ABA responsive polynucleotides and/or gene products that have similar transcription profiles or similar biological activities, and members of the same or similar biochemical pathways. Whole pathways or segments of pathways are controlled by transcription factor proteins and proteins controlling the activity of signal transduction pathways. Therefore, manipulation of such protein levels is especially useful for altering phenotypes and biochemical activities of plants. In addition, the combination of an ABA responsive polynucleotide and/or gene product with another environmentally responsive polynucleotide is also useful because of the interactions that exist between hormone-regulated pathways, stress and defence induced pathways, nutritional pathways and development.

[0428]Differential Expression of the Sequences in ABA Treated Plants

[0429]The relative levels of mRNA product in plants treated with ABA versus controls treated with water were measured. Results are presented in TABLE 10.

Brassinosteroid Responsive Genes, Gene Components and Products

[0430]Plant hormones are naturally occuring substances, effective in very small amounts, which act as signals to stimulate or inhibit growth or regulate developmental processes in plants. Brassinosteroids (BRs) are the most recently discovered, and least studied, class of plant hormones. The major physiological response affected by BRs is the longitudinal growth of young tissue via cell elongation and possibly cell division. Consequently, disruptions in BR metabolism, perception and activity frequently result in a dwarf phenotype. In addition, because BRs are derived from the sterol metabolic pathway, any perturbations to the sterol pathway can affect the BR pathway. In the same way, perturbations in the BR pathway can have effects on the later part of the sterol pathway and thus the sterol composition of membranes.

[0431]Changes in BR concentration in the surrounding environment or in contact with a plant result in modulation of many genes and gene products. These genes and/or products are responsible for effects on traits such as plant biomass and seed yield. These genes were discovered and characterized from a much larger set of genes by experiments designed to find genes whose mRNA abundance changed in response to application of BRs to plants.

[0432]While BR responsive polynucleotides and gene products can act alone, combinations of these polynucleotides also affect growth and development. Useful combinations include different BR responsive polynucleotides and/or gene products that have similar transcription profiles or similar biological activities, and members of the same or functionally related biochemical pathways. Whole pathways or segments of pathways are controlled by transcription factors and proteins controlling the activity of signal transduction pathways. Therefore, manipulation of such protein levels is especially useful for altering phenotypes and biochemical activities of plants. In addition, the combination of a BR responsive polynucleotide and/or gene product with another environmentally responsive polynucleotide is useful because of the interactions that exist between hormone-regulated pathways, stress pathways, nutritional pathways and development. Here, in addition to polynucleotides having similar transcription profiles and/or biological activities, useful combinations include polynucleotides that may have different transcription profiles but which participate in common or overlapping pathways.

[0433]Differential Expression of the Sequences in Epi-Brassinolide or Brassinozole Plants

[0434]The relative levels of mRNA product in plants treated with either epi-brassinolide or brassinozole were measured. Results are presented in TABLE 10.

Metabolism Affecting Genes, Gene Components and Products

Nitrogen Responsive Genes, Gene Components and Products

[0435]Nitrogen is often the rate-limiting element in plant growth, and all field crops have a fundamental dependence on exogenous nitrogen sources. Nitrogenous fertilizer, which is usually supplied as ammonium nitrate, potassium nitrate, or urea, typically accounts for 40% of the costs associated with crops, such as corn and wheat in intensive agriculture. Increased efficiency of nitrogen use by plants should enable the production of higher yields with existing fertilizer inputs and/or enable existing yields of crops to be obtained with lower fertilizer input, or better yields on soils of poorer quality. Also, higher amounts of proteins in the crops could also be produced more cost-effectively. “Nitrogen responsive” genes and gene products can be used to alter or modulate plant growth and development.

[0436]Differential Expression of the Sequences in Whole Seedlings, Shoots and Roots

[0437]The relative levels of mRNA product in whole seedlings, shoots and roots treated with either high or low nitrogen media were compared to controls. Results are presented in TABLE 10.

Viability Genes, Gene Components and Products

[0438]Plants contain many proteins and pathways that when blocked or induced lead to cell, organ or whole plant death. Gene variants that influence these pathways can have profound effects on plant survival, vigor and performance. The critical pathways include those concerned with metabolism and development or protection against stresses, diseases and pests. They also include those involved in apoptosis and necrosis. Viability genes can be modulated to affect cell or plant death. Herbicides are, by definition, chemicals that cause death of tissues, organs and whole plants. The genes and pathways that are activated or inactivated by herbicides include those that cause cell death as well as those that function to provide protection.

[0439]Differential Expression of the Sequences in Herbicide Treated Plants and Herbicide Resistant Mutants

[0440]The relative levels of mRNA product in plants treated with heribicide and mutants resistant to heribicides were compared to control plants. Results are presented in TABLE 10.

Stress Responsive Genes, Gene Components and Products

Cold Responsive Genes, Gene Components and Products

[0441]The ability to endure low temperatures and freezing is a major determinant of the geographical distribution and productivity of agricultural crops. Even in areas considered suiTable for the cultivation of a given species or cultivar, can give rise to yield decreases and crop failures as a result of aberrant, freezing temperatures. Even modest increases (1-2° C.) in the freezing tolerance of certain crop species would have a dramatic impact on agricultural productivity in some areas. The development of genotypes with increased freezing tolerance would provide a more reliable means to minimize crop losses and diminish the use of energy-costly practices to modify the microclimate.

[0442]Sudden cold temperatures result in modulation of many genes and gene products, including promoters. These genes and/or products are responsible for effects on traits such as plant vigor and seed yield.

[0443]Manipulation of one or more cold responsive gene activities is useful to modulate growth and development.

[0444]Differential Expression of the Sequences in Cold Treated Plants

[0445]The relative levels of mRNA product in cold treated plants were compared to control plants. Results are presented in TABLE 10.

Heat Responsive Genes, Gene Components and Products

[0446]The ability to endure high temperatures is a major determinant of the geographical distribution and productivity of agricultural crops. Decreases in yield and crop failure frequently occur as a result of aberrant, hot conditions even in areas considered suiTable for the cultivation of a given species or cultivar. Only modest increases in the heat tolerance of crop species would have a dramatic impact on agricultural productivity. The development of genotypes with increased heat tolerance would provide a more reliable means to minimize crop losses and diminish the use of energy-costly practices to modify the microclimate.

[0447]Changes in temperature in the surrounding environment or in a plant microclimate results in modulation of many genes and gene products.

[0448]Differential Expression of the Sequences in Heat Treated Plants

[0449]The relative levels of mRNA product in heat treated plants were compared to control plants. Results are presented in TABLE 10.

Drought Responsive Genes, Gene Components and Products

[0450]The ability to endure drought conditions is a major determinant of the geographical distribution and productivity of agricultural crops. Decreases in yield and crop failure frequently occur as a result of aberrant, drought conditions even in areas considered suiTable for the cultivation of a given species or cultivar. Only modest increases in the drought tolerance of crop species would have a dramatic impact on agricultural productivity. The development of genotypes with increased drought tolerance would provide a more reliable means to minimize crop losses and diminish the use of energy-costly practices to modify the microclimate.

[0451]Drought conditions in the surrounding environment or within a plant, results in modulation of many genes and gene products.

[0452]Differential Expression of the Sequences in Drought Treated Plants and Drought Mutants

[0453]The relative levels of mRNA product in drought treated plants and drought mutants were compared to control plants. Results are presented in TABLE 10.

Methyl Jasmonate (Jasmonate) Responsive Genes, Gene Components and Products

[0454]Jasmonic acid and its derivatives, collectively referred to as jasmonates, are naturally occurring derivatives of plant lipids. These substances are synthesized from linolenic acid in a lipoxygenase-dependent biosynthetic pathway. Jasmonates are signalling molecules which have been shown to be growth regulators as well as regulators of defense and stress responses. As such, jasmonates represent a separate class of plant hormones. Jasmonate responsive genes can be used to modulate plant growth and development.

[0455]Differential Expression of the Sequences in Methyl Jasmonate Treated Plants

[0456]The relative levels of mRNA product in methyl jasmonate treated plants were compared to control plants. Results are presented in TABLE 10.

SalicyliC Acid Responsive Genes, Gene Components and Products

[0457]Plant defense responses can be divided into two groups: constitutive and induced. Salicylic acid (SA) is a signaling molecule necessary for activation of the plant induced defense system known as systemic acquired resistance or SAR. This response, which is triggered by prior exposure to avirulent pathogens, is long lasting and provides protection against a broad spectrum of pathogens. Another induced defense system is the hypersensitive response (HR). HR is far more rapid, occurs at the sites of pathogen (avirulent pathogens) entry and precedes SAR. SA is also the key signaling molecule for this defense pathway.

[0458]Differential Expression of the Sequences in Salicylic Acid Treated Plants

[0459]The relative levels of mRNA product in salicylic acid treated plants were compared to control plants. Results are presented in TABLE 10.

Osmotic Stress Responsive Genes, Gene Components and Products

[0460]The ability to endure and recover from osmotic and salt related stress is a major determinant of the geographical distribution and productivity of agricultural crops. Osmotic stress is a major component of stress imposed by saline soil and water deficit. Decreases in yield and crop failure frequently occur as a result of aberrant or transient environmental stress conditions even in areas considered suitable for the cultivation of a given species or cultivar. Only modest increases in the osmotic and salt tolerance of a crop species would have a dramatic impact on agricultural productivity. The development of genotypes with increased osmotic tolerance would provide a more reliable means to minimize crop losses and diminish the use of energy-costly practices to modify the soil environment. Thus, osmotic stress responsive genes can be used to modulate plant growth and development.

[0461]Differential Expression of the Sequences in PEG Treated Plants

[0462]The relative levels of mRNA product in PEG treated plants were compared to control plants. Results are presented in TABLE 10.

Shade Responsive Genes, Gene Components and Products

[0463]Plants sense the ratio of Red (R):Far Red (FR) light in their environment and respond differently to particular ratios. A low R:FR ratio, for example, enhances cell elongation and favors flowering over leaf production. The changes in R:FR ratios mimic and cause the shading response effects in plants. The response of a plant to shade in the canopy structures of agricultural crop fields influences crop yields significantly. Therefore manipulation of genes regulating the shade avoidance responses can improve crop yields. While phytochromes mediate the shade avoidance response, the down-stream factors participating in this pathway are largely unknown. One potential downstream participant, ATHB-2, is a member of the RD-Zip class of transcription factors and shows a strong and rapid response to changes in the R:FR ratio. ATHB-2 overexpressors have a thinner root mass, smaller and fewer leaves and longer hypocotyls and petioles. This elongation arises from longer epidermal and cortical cells, and a decrease in secondary vascular tissues, paralleling the changes observed in wild-type seedlings grown under conditions simulating canopy shade. On the other hand, plants with reduced ATHB-2 expression have a thick root mass and many larger leaves and shorter hypocotyls and petioles. Here, the changes in the hypocotyl result from shorter epidermal and cortical cells and increased proliferation of vascular tissue. Interestingly, application of Auxin is able to reverse the root phenotypic consequences of high ATHB-2 levels, restoring the wild-type phenotype. Consequently, given that ATHB-2 is tightly regulated by phytochrome, these data suggest that ATHB-2 may link the Auxin and phytochrome pathways in the shade avoidance response pathway.

[0464]Shade responsive genes can be used to modulate plant growth and development.

[0465]Differential Expression of the Sequences in Far-Red Light Treated Plants

[0466]The relative levels of mRNA product in far-red light treated plants were compared to control plants. Results are presented in TABLE 10.

Viability Genes, Gene Components and Products

[0467]Plants contain many proteins and pathways that when blocked or induced lead to cell, organ or whole plant death. Gene variants that influence these pathways can have profound effects on plant survival, vigor and performance. The critical pathways include those concerned with metabolism and development or protection against stresses, diseases and pests. They also include those involved in apoptosis and necrosis. The applicants have elucidated many such genes and pathways by discovering genes that when inactivated lead to cell or plant death.

[0468]Herbicides are, by definition, chemicals that cause death of tissues, organs and whole plants. The genes and pathways that are activated or inactivated by herbicides include those that cause cell death as well as those that function to provide protection. The applicants have elucidated these genes.

[0469]The genes defined in this section have many uses including manipulating which cells, tissues and organs are selectively killed, which are protected, making plants resistant to herbicides, discovering new herbicides and making plants resistant to various stresses.

[0470]Viability genes were also identified from a much larger set of genes by experiments designed to find genes whose mRNA products changed in concentration in response to applications of different herbicides to plants. Viability genes are characteristically differentially transcribed in response to fluctuating herbicide levels or concentrations, whether internal or external to an organism or cell, The MA_diff Table reports the changes in transcript levels of various viability genes.

Early Seedling-Phase Specific Responsive Genes, Gene Components and Products

[0471]One of the more active stages of the plant life cycle is a few days after germination is complete, also referred to as the early seedling phase. During this period the plant begins development and growth of the first leaves, roots, and other organs not found in the embryo. Generally this stage begins when germination ends. The first sign that germination has been completed is usually that there is an increase in length and fresh weight of the radicle. Such genes and gene products can regulate a number of plant traits to modulate yield. For example, these genes are active or potentially active to a greater extent in developing and rapidly growing cells, tissues and organs, as exemplified by development and growth of a seedling 3 or 4 days after planting a seed.

[0472]Rapid, efficient establishment of a seedling is very important in commercial agriculture and horticulture. It is also vital that resources are approximately partitioned between shoot and root to facilitate adaptive growth, Phototropism and geotropism need to be established. All these require post-germination process to be sustained to ensure that vigorous seedlings are produced. Early seedling phase genes, gene components and products are useful to manipulate these and other processes.

Guard Cell Genes, Gene Components and Products

[0473]Scattered throughout the epidermis of the shoot are minute pores called stomata. Each stomal pore is surrounded by two guard cells. The guard cells control the size of the stomal pore, which is critical since the stomata control the exchange of carbon dioxide, oxygen, and water vapor between the interior of the plant and the outside atmosphere. Stomata open and close through turgor changes driven by ion fluxes, which occur mainly through the guard cell plasma membrane and tonoplast. Guard cells are known to respond to a number of external stimuli such as changes in light intensity, carbon dioxide and water vapor, for example. Guard cells can also sense and rapidly respond to internal stimuli including changes in ABA, auxin and calcium ion flux.

[0474]Thus, genes, gene products, and fragments thereof differentially transcribed and/or translated in guard cells can be useful to modulate ABA responses, drought tolerance, respiration, water potential, and water management as examples. All of which can in turn affect plant yield including seed yield, harvest index, fruit yield, etc.

[0475]To identify such guard cell genes, gene products, and fragments thereof, Applicants have performed a microarray experiment comparing the transcript levels of genes in guard cells versus leaves. Experimental data is shown below.

Nitric Oxide Responsive Genes, Gene Components and Products

[0476]The rate-limiting element in plant growth and yield is often its ability to tolerate suboptimal or stress conditions, including pathogen attack conditions, wounding and the presence of various other factors. To combat such conditions, plant cells deploy a battery of inducible defense responses, including synergistic interactions between nitric oxide (NO), reactive oxygen intermediates (ROS), and salicylic acid (SA). NO has been shown to play a critical role in the activation of innate immune and inflammatory responses in animals. At least part of this mammalian signaling pathway is present in plants, where NO is known to potentiate the hypersensitive response (HR). In addition, NO is a stimulator molecule in plant photomorphogenesis.

[0477]Changes in nitric oxide concentration in the internal or surrounding environment, or in contact with a plant, results in modulation of many genes and gene products.

[0478]In addition, the combination of a nitric oxide responsive polynucleotide and/or gene product with other environmentally responsive polynucleotides is also useful because of the interactions that exist between hormone regulated pathways, stress pathways, pathogen stimulated pathways, nutritional pathways and development.

[0479]Nitric oxide responsive genes and gene products can function either to increase or dampen the above phenotypes or activities either in response to changes in nitric oxide concentration or in the absence of nitric oxide fluctuations. More specifically, these genes and gene products can modulate stress responses in an organism. In plants, these genes and gene products are useful for modulating yield under stress conditions. Measurements of yield include seed yield, seed size, fruit yield, fruit size, etc.

Shoot-Apical Meristem Genes, Gene Components and Products

[0480]New organs, stems, leaves, branches and inflorescences develop from the stem apical meristem (SAM). The growth structure and architecture of the plant therefore depends on the behavior of SAMs. Shoot apical meristems (SAMs) are comprised of a number of morphologically undifferentiated, dividing cells located at the tips of shoots. SAM genes elucidated here are capable of modifying the activity of SAMs and thereby many traits of economic interest from ornamental leaf shape to organ number to responses to plant density.

[0481]In addition, a key attribute of the SAM is its capacity for self-renewal. Thus, SAM genes of the instant invention are useful for modulating one or more processes of SAM structure and/or function including (I) cell size and division; (II) cell differentiation and organ primordia. The genes and gene components of this invention are useful for modulating any one or all of these cell division processes generally, as in timing and rate, for example. In addition, the polynucleotides and polypeptides of the invention can control the response of these processes to the internal plant programs associated with embryogenesis, and hormone responses, for example.

[0482]Because SAMs determine the architecture of the plant, modified plants will be useful in many agricultural, horticultural, forestry and other industrial sectors. Plants with a different shape, numbers of flowers and seed and fruits will have altered yields of plant parts. For example, plants with more branches can produce more flowers, seed or fruits. Trees without lateral branches will produce long lengths of clean timber. Plants with greater yields of specific plant parts will be useful sources of constituent chemicals.

[0483]The invention being thus described, it will be apparent to one of ordinary skill in the art that various modifications of the materials and methods for practicing the invention can be made. Such modifications are to be considered within the scope of the invention as defined by the following claims.

[0484]Each of the references from the patent and periodical literature cited herein is hereby expressly incorporated in its entirety by such citation.

TABLE I
REFERENCE TABLE
Max Len. Seq.:
rel to:
Clone IDs:
1093453
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 1
- Ceres SEQ ID NO: 4788142
PolyP SEQ
- Pat. Appln. SEQ ID NO 2
- Ceres SEQ ID NO 4788143
- Loc. SEQ ID NO 1: @ 89 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 1
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 63.8
- Align. Len.: 105
- Loc. SEQ ID NO 2: 1 −&gt; 92 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 3
- Ceres SEQ ID NO 4788144
- Loc. SEQ ID NO 1: @ 167 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 2
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 63.8
- Align. Len.: 105
- Loc. SEQ ID NO 3: 1 −&gt; 66 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 4
- Ceres SEQ ID NO 4788145
- Loc. SEQ ID NO 1: @ 183 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
Max Len. Seq. :
rel to:
Clone IDs:
1079596
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 5
- Ceres SEQ ID NO: 4796909
PolyP SEQ
- Pat. Appln. SEQ ID NO 6
- Ceres SEQ ID NO 4796910
- Loc. SEQ ID NO 5: @ 94 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 3
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 63.9
- Align. Len.: 147
- Loc. SEQ ID NO 6: 1 −&gt; 128 aa.
Polyp SEQ
- Pat. Appln. SEQ ID NO 7
- Ceres SEQ ID NO 4796911
- Loc. SEQ ID NO 5: @ 172 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 4
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 63.9
- Align. Len.: 147
- Loc. SEQ ID NO 7: 1 −&gt; 102 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 8
- Ceres SEQ ID NO 4796912
- Loc. SEQ ID NO 5: @ 244 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 5
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 63.9
- Align. Len.: 147
- Loc. SEQ ID NO 8: 1 −&gt; 78 aa.
END_OF_FILE
Max Len. Seq. :
rel to:
Clone IDs:
8161
Pub gDNA:
gi No: 22329272
Gen. seq. in cDNA:
129945 . . . 129790OCKHAM3-CDS
129087 . . . 128929OCKHAM3-CDS
128845 . . . 128653OCKHAM3-CDS
128277 . . . 128165OCKHAM3-CDS
128081 . . . 128046OCKHAM3-CDS
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 9
- Ceres SEQ ID NO: 12321174
PolyP SEQ
- Pat. Appln. SEQ ID NO 10
- Ceres SEQ ID NO 12321175
- Loc. SEQ ID NO 9: @ 113 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 6
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 41.2
- Align. Len.: 102
- Loc. SEQ ID NO 10: 22 −&gt; 118 aa.
Max Len. Seq. :
rel to:
Clone IDs:
96
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 11
- Ceres SEQ ID NO: 12323601
- SEQ 11 w. TSS:
36
PolyP SEQ
- Pat. Appln. SEQ ID NO 12
- Ceres SEQ ID NO 12323602
- Loc. SEQ ID NO 11: @ 2 nt.
- Loc. Sig. P. SEQ ID NO 12: @ 22 aa.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 7
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 246
- Loc. SEQ ID NO 12: 28 −&gt; 273 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 13
- Ceres SEQ ID NO 12323603
- log. SEQ ID NO 11: @ 83 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 8
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 246
- Loc. SEQ ID NO 13: 1 −&gt; 246 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 14
- Ceres SEQ ID NO 12323604
- Loc. SEQ ID NO 11: @ 188 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 9
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 246
- Loc. SEQ ID NO 14: 1 −&gt; 211 aa.
Max Len. Seq. :
rel to:
Clone IDs:
8490
Pub gDNA:
gi No: 22323163
Gen. seq. in cDNA:
147882 . . . 147775OCKHAM3-CDS
147419 . . . 147237OCKBAM3-CDS
147148 . . . 146863OCKHAM3-CDS
146779 . . . 146673OCKHAM3-CDS
146592 . . . 146536OCKHAM3-CDS
gi No: 22328163
Gen. seq. in cDNA:
7882   . . . 7775OCKHAM3-CDS
7419   . . . 7237OCKHAM3-CDS
7148   . . . 6863OCKHAM3-CDS
6779   . . . 6673OCKHAM3-CDS
6592   . . . 6536OCKHAM3-CDS
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 15
- Ceres SEQ ID NO: 13491409
PolyP SEQ
- Pat. Appln. SEQ ID NO 16
- Ceres SEQ ID NO 13491410
- Loc. SEQ ID NO 15: @ 2 nt.
- Loc. Sig. P. SEQ ID NO 16: @ 21 aa.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 10
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 246
- Loc. SEQ ID NO 16: 27 −&gt; 272 aa.
Polyp SEQ
- Pat. Appln. SEQ ID NO 17
- Ceres SEQ ID NO 13491411
- Loc. SEQ ID NO 15: @ 80 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 11
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 246
- Loc. SEQ ID NO 17: 1 −&gt; 246 aa.
PolyP SEQ
- Pat. Appln. SEQ ID NO 18
- Ceres SEQ ID NO 13491412
- Loc. SEQ ID NO 15: @ 185 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
- Align. NO 12
- gi No 30694168
- Desp. : expressed protein [<i>Arabidopsis thaliana</i>]
- % Idnt. : 99.6
- Align. Len.: 245
- Loc. SEQ ID NO 18: 1 −&gt; 211 aa.
END_OF_FILE
Max Len. Seq. :
rel to:
Clone IDs:
305463
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 1
- Ceres SEQ ID NO: 12355477
- SEQ 1 w. TSS:
27
Polyp SEQ
- Pat. Appln. SEQ ID NO 2
- Ceres SEQ ID NO 12355478
- Loc. SEQ ID NO 1: @ 462 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
PolyP SEQ
- Pat. Appln. SEQ ID NO 3
- Ceres SEQ ID NO 12355479
- Loc. SEQ ID NO 1: @ 549 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
Polyp SEQ
- Pat. Appln. SEQ ID NO 4
- Ceres SEQ ID NO 12355480
- Loc. SEQ ID NO 1: @ 597 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
Max Len. Seq. :
rel to:
Clone IDs:
258437
(Ac) cDNA SEQ
- Pat. Appln. SEQ ID NO: 5
- Ceres SEQ ID NO: 12410516
- SEQ 5 w. TSS:
22,79,83,85
Polyp SEQ
- Pat. Appln. SEQ ID NO 6
- Ceres SEQ ID NO 12410517
- Loc. SEQ ID NO 5: @ 553 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
PolyP SEQ
- Pat. Appln. SEQ ID NO 7
- Ceres SEQ ID NO 12410518
- Loc. SEQ ID NO 5: @ 637 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
Polyp SEQ
- Pat. Appln. SEQ ID NO 8
- Ceres SEQ ID NO 12410519
- Loc. SEQ ID NO 5: @ 667 nt.
(C) Pred. PP Nom. &amp; Annot.
(Dp) Rel. AA SEQ
END_OF_FILE
TABLE 3
Matrix com
28293031323334353637383940
2222222222222
1221212222221
vekgaetptsasgmgyisaakg
41424344454647484950515253
2222222222222
2222323112121
kneryvmledstaemgwtndekrh
54555657585960616263646566
2222222222222
3212211111112
smrlsylikssmeasfvde
67686970717273747576777879
2222222222222
1111211332322
qlynshlganslhrgpkhrndea
80818283848586878889909192
2222222222222
1221111212111
nvgstestrfsgsagrk
93949596979899100101102103104105
222122221222222
1111211223324
psqeqafkvalihrqdregefvyl
106107108109110111112113114115116117118
2222222222222
3233444434222
wvcqekysiemnekrvytikedpqkarptdesvdharpiv
119120121122123124125126127128129130131
2222222222222
1112223324223
ngrhrgsganakskchcecgdfvlprae
132133134135136137138139140141142143144
2222222222222
2113322212223
snpwimvkrqhryfkrplrvdkctgr
145146147148149150151152153154155156157
2222222222222
3333313423433
qsginvpahvqhtsgdeagpvgmennavqsaevrpvgl
158159160161162163164165166167168169170
2222222222222
3444233233312
sdvshgdselgnsgygdktskqvgaisdcrlskesgp
171172173174175176177178179180181182183
2222222222222
2434323222133
stavedsatshnalgrkrqeslrsgsahscgrkp
184185186187188189190191192193194195196
2222222222222
3432233323112
dgeherpdprqkilslavhkgeaesatrevst
197198199200201202203204205206207208209
2222222222222
1111332223322
dqnfvapndeedgeiakeqgasesnt
210211212213214215216217218219220221222
2222222222222
2231341322212
gesasmckkarmcyqktksvrmrmlser
223
2
3
sat
TABLE 4
matrix_e17
2122232425262728293031323334
22222222222222
22354533352332
sestdstdgselastlsqtynsfgvlyegdgeqshegtaetlvsa
6162636465666768697071727374
222122222222222
12111512232342
eassfvdnserqlsyhndeshlsmgndsal
121122123124125126127128129130131132133134
22222222222222
44366267655322
rskthsrkgiagrankengrkqeschdcratedgrvaiflviselqptfrsaetsdnpewf
181182183184185186187188189190191192193194
22222222222222
45465646675451
hnsesgryprlvpdyecsphrdepdrpkqsqdkeismlytsvliakvlghyclgsedaensdaeitre
3536373839404142434445464748
22222222222222
44456776787541
srqtmlqsyedmsfgkaaeqpsdgevrmkkntliqe edagtlydptsikmktlseepsaqr<img id="CUSTOM-CHARACTER-00001" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> tapsgegqaw
7576777879808182838485868788
22222222222222
22569766655697
lqgsksrygnkqesgednwm<img id="CUSTOM-CHARACTER-00002" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> ntksae<img id="CUSTOM-CHARACTER-00003" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> vptckrsgptklepnyskshdrltrspmrqhapkfkdtnengdatvql
135136137138139140141142143144145146147148
22222222222222
44234367467968
lmvrkrqfhryfrknrtpsnlsregavprdsg<img id="CUSTOM-CHARACTER-00004" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> krcvtsgqahqlsrahnitdnspnpdaisrvgqarli
195196197198199200201202203
222222222
332111632
vmastmdgqnfvmaiprndeed
495051525354555657585960
222222222222
121214312423
tndekrhsmrnlmsyliknsdsymil
8990919293949596979899100101102
22222222222222
54755244322244
sdcnhgncargtipnskcarhpitskspqesaegadqgefyktvalhfihrkql
149150151152153154155156157158159160161162
22222222222222
84853655447574
tslvqngdspeefasgc<img id="CUSTOM-CHARACTER-00005" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> plvgaeqnneaqgyqnsatvarmtvagtsdtlsthgvarselkvnksgfp<img id="CUSTOM-CHARACTER-00006" he="2.46mm" wi="2.46mm" file="US20120216317A1-20120823-P00899.TIF" alt="text missing or illegible when filed" img-content="character" img-format="tif"/> gdsn
103104105106107108109110111112113114115116
22222222222222
52724445574667
dgrengefsvcynlwcqektkygsimkvneskrvcyfikrvempqrkypatvedesnkmdhyaptsl
163164165166167168169170171172173174175176
22222222222222
67686755576544
kltqsdkvqrihsgakvepivsgdmcrsvlisckped sgcfdgpakssdtayasvgeitsthaqesnftglrstkqld
117118119120
2222
5734
rpqdkilvtamdnspgkvs
177178179180
2222
5434
qfhstlitasclswer
TABLE 9
PARAMETERS FOR DIFFERENTIAL ANALYSIS
Expt
Utility SectionRep IDShort_NameParameterValue
Viability107881At_Herbicide_v2_cDNA_PTimepoint (hr)4
107881At_Herbicide_v2_cDNA_PTreatmentGlean vs. No Treatment
107891At_Herbicide_v2_cDNA_PTimepoint (hr)12
107891At_Herbicide_v2_cDNA_PTreatmentTrimec vs. No Treatment
Root108429At_Tissue_Specific_Expression_cDNA_PProbe Amount50
108429At_Tissue_Specific_Expression_cDNA_PProbe Methodoperon
108429At_Tissue_Specific_Expression_cDNA_PTissueGreen Flower vs. Whole Plant
Root108434At_Root_Tips_cDNA_PTissueRoot Tips
Shoot Meristem108435At_stm_Mutants_cDNA_PRant Linewt Landsburg vs stm
108435At_stm_Mutants_cDKA_PTissueShoot Apical Meristem Region
Reproductive and Seed &amp;108437At_Tissue_Specific_Expression_cDNA_PProbe Amount33
Fruit Development108437At_Tissue_Specific_Expression_cDNA_PProbe Methodoperon
108437At_Tissue_Specific_Expression_cDNA_PTissue&lt;5 mm Siliques vs. Whole Plant
Reproductive and Seed &amp;108438At_Tissue_Specific_Expression_cDNA_PProbe Amount33
Fruit Development108438At_Tissue_Specific_Expression_cDNA_PProbe Methodoperon
108438At_Tissue_Specific_Expression_cDNA_PTissue5 wk Siliques vs. Whole Plant
Root108439At_Tissue_Specific_Expression_cDNA_PProbe Amount33
108439At_Tissue_Specific_Expression_cDNA_PProbe Methodoperon
108439At_Tissue_Specific_Expression_cDNA_PTissueRoots (2 wk) vs. Whole Plant
Imbibition &amp; Germination108461At_Germinating_Seeds_cDNA_PAge1 vs. 0
108461At_Germinating_Seeds_cDNA_PTissueGerminating Seeds
Imbibition &amp; Germination108462At_Germinating_Seeds_cDNA_PAge2 vs. 0
108462At_Germinating_Seeds_cDNA_PTissueGreminating Seeds
Early Seedling Phase108463At_Germinating_Seeds_cDNA_PAge3 vs. 0
108463At_Germinating_Seeds_cDNA_PTissueGerminating Seeds
Early Seedling Phase108464At_Germinating_Seeds_cDNA_PAge4 vs. 0
108464At_Germinating_Seeds_cDNA_PTissueGerminating Seeds
Viability108465At_Herbicide_v3_1_cDNA_PTimepoint (hr)12
108465At_Herbicide_v3_1_cDNA_PTreatmentRoundup vs. No Treatment
Drought and Reproductive108473At_Drought_Flowers_cDNA_PTimepoint (hr)7 d
108473At_Drought_Flowers_cDNA_PTissueFlowers
108473At_Drought_Flowers_cDNA_PTreatmentDrought vs. No Drought
Shoot Meristem108480At_Shoot_Apices_cDNA_PPlant LineWs-2
108480At_Shoot_Apices_cDNA_PTreatment1 uM BR vs. No Treatment
Shoot Meristem108481At_Shoot_Apices_cDNA_PPlant LineWs-2
108481At_Shoot_Apices_cDNA_PTreatment1 uM BRZ vs. No Treatment
Leaves108488At_50mM_NH4NO3_L-to-H_Rosette_cDNA_PTimepoint (hr)2
Heat108523Zm_42deg_Heat_PTemperatureHeat (42 deg C.)
108523Zm_42deg_Heat_PTimepoint (hr)6
108523Zm_42deg_Heat_PTissueAerial
Imbibition &amp; Germination108528Zm_Imbibed_Seeds_PAge5 vs. 2
108528Zm_Imbibed_Seeds_PTissueAerial vs. Embryo
108528Zm_Imbibed_Seeds_PTreatmentImbibition
Imbibition &amp; Germination108530Zm_Imbibed_Seeds_PAge6 vs. 2
108530Zm_Imbibed_Seeds_PTissueAerial vs. Embryo
108530Zm_Imbibed_Seeds_PTreatmentImbibition
Imbibition &amp; Germination,108543Zm_Imbibed_Embryo_Endosperm_PAge2
Reproductive108543Zm_Imbibed_Embryo_Endosperm_PTissueEmbryo vs. Whole Plant
108543Zm_Imbibed_Embryo_Endosperm_PTreatmentImbibed
Imbibition &amp; Germination108546Zm_Imbibed_Seeds_PAge3 vs.2
108546Zm_Imbibed_Seeds_PTissueRoots vs. Embryo
103546Zm_Imbibed_Seeds_PTreatmentImbibition
Jasmonale108569At_0.001%_MeJA_cDNA_PTimepoint (hr)6
108569At_0.001%_MeJA_cDNA_PTissueAerial
108569At_0.001%_MeJA_cDNA_PTreatment0.001% MeJA vs. No Treatment
Heat108577At_42deg_Heat_cDNA_PTemperature42 vs. 22
108577At_42deg_Heat_cDNA_PTimepoint (hr)6
108577At_42deg_Heat_cDNA_PTissueAerial
Cold108579At_4deg_Cold_cDNA_PTemperature4 vs. 22
108579At_4deg_Cold_cDNA_PTimepoint (hr)6
108579At_4deg_Cold_cDNA_PTissueAerial
Root and Root Hairs108594At_Ler-rhl_Root_cDNA_PPlant LineLer_rhl
108594At_Ler-rhl_Root_cDNA_PTissueRoot
ABA, Drought, Germination108614At_100uM_ABA_Mutants_cDNA_PPlant LineCS24
108614At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
108614At_100uM_ABA_Mutants_cDNA_PTissueAerial
108614At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Drought, Germination108622At_100uM_ABA_Mutants_cDNA_PPlant LineCS22
108622At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
108622At_100uM_ABA_Mutants_cDNA_PTissueAerial
108622At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
Viability108629At_Herbicide_v3_1_cDNA_PTimepoint (hr)1
108629At_Herbicide_v3_1_cDNA_PTreatmentGlean vs. No Treatment
Viability108630At_Herbicide_v3_1_cDNA_PTimepoint (hr)1
108630At_Herbicide_v3_1_cDNA_PTreatmentTrimec vs. No Treatment
Salicylic Add108668At_2mM_SA_cDNA_PPlant LineWS
108668At_2mM_SA_cDNA_PTimepoint (hr)6
108665At_2mM_SA_cDNA_PTreatment2 mM SA vs. No Treatment
Reproductive and Seed &amp;108687Zm_Embryos-Flowers_PTissueEmbryo
Fruit Development108688Zm_Embryos-Flowers_PTissueImmature Flowers
ABA, Drought, Germination20000069At_100uM_ABA_Mutants_cDNA_PPlant LineCS23
20000069At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000069At_100uM_ABA_Mutants_cDNA_PTissueAerial
20000069At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Drought, Germination20000070At_100uM_ABA_Mutants_cDNA_PPlant LineCS24
20000070At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000070At_100uM_ABA_Mutants_cDNA_PTissueAerial
20000070At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ASA, Drought, Germination20000071At_100uM_ABA_Mutants_cDNA_PPlant LineCS8104
20000071At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)3
20000071At_100uM_ABA_Mutants_cDNA_PTissueAerial
20000071At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Drought, Germination20000072At_100uM_ABA_Mutants_cDNA_PPlant LineCS8105
20000072At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000072At_100uM_ABA_Mutants_cDNA_PTissueAerial
20000072At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Drought, Germination20000086At_100uM_ABA_Mutants_cDNA_PPlant LineCS22
20000086At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000086At_100uM_ABA_Mutants_cDNA_PTissueaerial
20000086At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Draught, Germination20000087At_100uM_ABA_Mutants_cDNA_PPlant LineWS
20000087At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000087At_100uM_ABA_Mutants_cDNA_PTissueaerial
20000087At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
ABA, Drought, Germination20000088At_100uM_ABA_Mutants_cDNA_PPlant LineLandsberg
20000088At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000088At_100uM_ABA_Mutants_cDNA_PTissueaeriel
20000088At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
Salicylic Acid20000090At_2mM_SA_CS3726-Columbia_cDNA_PPlant LineColumbia
20000090At_2mM_SA_CS3726-Columbia_cDNA_PTime point (hr)6
20000090At_2mM_SA_CS3726-Columbia_cDNA_PTissueAerial
20000090At_2mM_SA_CS3726-Columbia_cDNA_PTreatment2 mM SA vs. No Treatment
Heat20000111At_42deg_Heat_cDNA_PTemperature42 vs. 23
20000111At_42deg_Heat_cDNA_PTimepoint (hr)5
20000111At_42deg_Heat_cDNA_PTissueAerial
Heat20000113At_42deg_Heat_cDNA_PTemperature42 vs. 23
20000113At_42deg_Heat_cDNA_PTimepoint (hr)8
20000113At_42deg_Heat_cDNA_PTissueAerial
ABA, Drought, Germination20000117At_100uM_ABA_Mutants_cDNA_PPlant Linecolumbia
20000117At_100uM_ABA_Mutants_cDNA_PTimepoint (hr)6
20000117At_100uM_ABA_Mutants_cDNA_PTissueaerial
20000117At_100uM_ABA_Mutants_cDNA_PTreatment100 uM ABA vs. No Treatment
Heat20000171At_42deg_Heat_PProbe MethodmRNA vs. mRNA
20000171At_42deg_Heat_PTemperature42 vs. 22
20000171At_42deg_Heat_PTimepoint (hr)1
20000171At_42deg_Heat_PTissueAerial
Heat20000173At_42deg_Heat_PProbe MethodmRNA vs. mRNA
20000173At_42deg_Heat_PTemperature42 vs. 22
20000173At_42deg_Heat_PTimepoint (hr)6
20000173At_42deg_Heat_PTissueAerial
Early Seedling Phase20000179At_Germinating_Seeds_PAge6 vs. 0
20000179At_Germinating_Seeds_PTissueGerminating Seeds
Early Seedling Phase20000180At_Germinating_Seeds_PAge24 vs. 0
20000180At_Germinating_Seeds_PTissueGerminating Seeds
Salicylic Acid20000182At_2mM_SA_PTimepoint (hr)6
20000182At_2mM_SA_PTissueAerial
20000182At_2mM_SA_PTreatment2 mM SA vs. No Treatment
Leaves, Shoot Meristem20000184At_Shoots_PAge7
20000184At_Shoots_PTissueShoots vs. Whole Plant
Root20000185At_Roots_PAge7
20000185At_Roots_PTissueRoots vs. Whole Plant
Cold20000213At_4deg_Cold_PTemperature4 vs. 22
20000213At_4deg_Cold_PTimepoint (hr)2
Seed and Fruit Development20000234At_Siliques_PTissue&lt;5 mm Siliques vs. Whole Plant
Seed and Fruit Development20000235At_Siliques_YF_6-05-02_PTissue5-10 mm Siliques vs. Whole Plant
Seed and Fruit Development20000236At_Siliques_PTissue&gt;10 mm Siliques vs. Whole Plant
Reproductive and Seed &amp;20000264At_Open_Flower_PTissueOpen Flower vs. Whole Plant
Fruit Development
Reproductive and Seed &amp;20000265At_Open_Flower_PTissueClosed Bud vs. Whole Rant
Fruit Development
Reproductive and Seed &amp;20000286At_Open_Flower_PTissueHalf Open vs. Whole Plant
Fruit Development
Drought20000437At_Drought_PTimepoint (hr)24
20000437At_Drought_PTissueWhole Plant
20000437At_Drought_PTreatmentDrought vs. No Draught
Leaves, Shoot Meristem20000438At_Shoots_PAge14
20000438At_Shoots_PTissueShoots vs. Whole Plant
Roots20000439At_Roots_PAge14
20000439At_Roots_PTissueRoots vs. Whole Plant
Brassinolide20000441At_1uM_BR-BRZ_PTissueShoot Apices
20000441At_1uM_BR-BRZ_PTreatment1 uM BR vs. No Treatment
20000443At_1uM_BR-BRZ_PTissueShoot Apices
20000443At_1uM_BR-BRZ_PTreatment1 uM BRZ vs. No Treatment
Salicylic Acid20000478Zm_5mM_SA_PAge8
20000478Zm_5mM_SA_PPlant LineHybrid
20000478Zm_5mM_SA_PTimepoint (hr)72
20000478Zm_5mM_SA_PTissueAerial
20000478Zm_5mM_SA_PTreatment5 mM SA vs. No Treatment
Reproductive and Seed &amp;20000493Zm_Hybrid_Seed_Dev_PDAP20 vs. 12
Fruit Development20000493Zm_Hybrid_Seed_Dev_PPlant LineHybrid
20000493Zm_Hybrid_Seed_Dev_PTissueEndosperm vs. Unfert Floret
Guard Cells20000495At_Guard_Cells_PHarvest DateAug. 2, 2002
20000495At_Guard_Cells_POrganism
20000495At_Guard_Cells_PTissueGuard Cells vs. Leaves
PEG20000527At_10%_PEG_PAge20
20000527At_10%_PEG_PTissueAerial
20000527At_10%_PEG_PTreatment10% PEG vs. No Treatment
ABA, Drought, Germination20000573At_100uM_ABA_Mutants_POrganism
20000573At_100uM_ABA_Mutants_PPlant LineCS22 vs. Ler wt
20000573At_100uM_ABA_Mutants_PTimepoint (hr)N/A
20000573At_100uM_ABA_Mutants_PTissueWhole Plant
20000573At_100uM_ABA_Mutants_PTreatmentNone
Viability20000629Zm_Herbicide-Treatments_PTimepoint (hr)12
20000629Zm_Herbicide-Treatments_PTissueAerial
20000629Zm_Herbicide-Treatments_PTreatmentTrimec vs. No Treatment
Drought20000638At_Drought_cDNA_PTimepoint (hr)144
20000838At_Drought_cDNA_PTissuesdf
Reproductive20000794At_Petals_PAge23-25 days
20000794At_Petals_PTissuePetals vs. Whole plant
Shade20001247At_Far-red-induction_PAge7
20001247At_Far-red-induction_PLightFar Red vs. White
20001247At_Far-red-induction_PPlant LineColumbia
20001247At_Far-red-induction_PTimepoint (hr)1
Shade20001248At_Far-red-induction_PAge7
20001248At_Far-red-induction_PLightFar Red vs. White
20001248At_Far-red-induction_PPlant LineColumbia
20001248At_Far-red-induction_PTimepoint (hr)4
Shade20001450At_Far-red-induction_PAge7
20001450At_Far-red-inducfion_PLightFar Red vs. White
20001450At_Far-red-induction_PPlant LineColumbia
20001450At_Far-red-induction_PTimepoint (hr)8
Shade20001451At_Far-red-induction_PAge7
20001451At_Far-red-induction_PLightFar Red vs. White
20001451At_Far-red-induction_PPlant LineColumbia
20001451At_Far-red-induction_PTimepoint (hr)24
Nitrogen20001459At_50mM_NH4NO3_L-to-H_PTimepoint (hr)4
20001459At_50mM_NH4NO3_L-to-H_PTissueSiliques
20001459At_50mM_NH4NO3_L-to-H_PTreatment50 mM NH4NO3 vs. 100 mM
Manitol
Viability20000530Zm_2-4D_YF_8-26-02_POrganism
20000530Zm_2-4D_YF_8-26-02_PTimepoint (hr)48
20000530Zm_2-4D_YF_8-26-02_PTissueAerial
20000530Zm_2-4D_YF_8-26-02_PTreatment2,4-D vs. No Treatment
Guard Cells20000570At_Guard_Cells_JD_9-9-02_cDNA_PHarvest DateJul. 19, 2002
20000570At_Guard_Cells_JD_9-9-02_cDNA_POrganismCanola
20000570At_Guard_Cells_JD_9-9-02_cDNA_PTissueGuard Cells vs. Leaves
TABLE 10
MA_DIFF TABLE
RESULTS FOR DIFFERENTIAL EXPRESSION ANALYSIS
Value (averageDifferential
ClonecDNABiomaterialExpt_Rep_IDShort_Namelog ratio)Differential(+/−)
9612323601158081020000527At_10%_PEG_P1.5549164761+
9612323601158081020000573At_100uM_ABA_Mutants_P1.4338537891+
9612323601158081020000441At_1uM_BR-BRZ_P−3.010706617−1
9612323601158081020000443At_1uM_BR-BRZ_P−2.748840687−1
9612323601158081020000171At_42deg_Heat_P1.5141398091+
9612323601158081020000173At_42deg_Heat_P−1.71925392−1
961232360123030108577At_42deg_Heat_cDNA_P−3.338050794−1
9612323801158081020000213At_4deg_Cold_P2.8136288041+
961232360123030108579At_4deg_Cold_cDNA_P3.9993111241+
9612323601158081020001459At_50mM_NH4NO3_L-to-H_P−1.715098188−1
9612323601158081020000437At_Drought_P4.2202272811+
9612323601158081020001247At_Far-red-induction_P−4.634953394−1
9612323601158081020001248At_Far-red-induction_P5.5925988251+
9612323601158081020001450At_Far-red-induction_P1.6499153151+
9612323601158081020000180At_Germinating_Seeds_P−2.680555133−1
9612323601158081020000495At_Guard_Cells_P−3.247865708−1
9612323601158081020000264At_Open_Flower_P−2.752089532−1
9612323601158081020000185At_Roots_P−4.966099796−1
9612323601158081020000439At_Roots_P−4.736820319−1
9612323601158081020000438At_Shoots_P−4.72150623−1
9612323601158081020000234At_Siliques_P−2.874162085−1
9612323601158081020000235At_Siliques_P−2.246390758−1
9612323601158081020000236At_Siliques_P−2.46053553−1
81611232117419239108569At_0.001%_MeJA_cDNA_P−1.173013726−1
816112321174158001220000527At_10%_PEG_P1.2590788471+
8161123211741923920000069At_100uM_ABA_Mutants_cDNA_P4.7404819261+
8161123211741923920000070At_100uM_ABA_Mutants_cDNA_P3.6700699071+
8161123211741923920000071At_100uM_ABA_Mutants_cDNA_P3.6087874721+
8161123211741923920000086At_100uM_ABA_Mutants_cDNA_P3.0270397751+
8161123211741923920000087At_100uM_ABA_Mutants_cDNA_P2.4232966881+
8161123211741923920000088At_100uM_ABA_Mutants_cDNA_P2.8562060361+
8161123211741923920000117At_100uM_ABA_Mutants_cDNA_P3.4859935471+
81611232117419239108614At_100uM_ABA_Mutants_cDNA_P−1.365108521−1
81611232117419239108622At_100uM_ABA_Mutants_cDNA_P−1.321545662−1
816112321174158001220000441At_1uM_BR-BRZ_P−2.735405149−1
816112321174158001220000443At_1uM_BR-BRZ_P−2.242959206−1
8161123211741923920000090At_2mM_SA_CS3726-Columbia_cDNA_P2.7291917391+
81611232117419239108668At_2mM_SA_cDNA_P−1.508606549−1
816112321174158001220000182At_2mM_SA_P−1.704743738−1
8161123211741923920000111At_42deg_Heat_cDNA_P−2.464590235−1
8161123211741923920000113At_42deg_Heat_cDNA_P−1.876879573−1
816112321174158001220000173At_42deg_Heat_P−2.821092623−1
816112321174158001220000213At_4deg_Cold_P4.5999734911+
81611232117419239108579At_4deg_Cold_cDNA_P3.7079626281+
81611232117419239108488At_50mM_NH4NO3_L-to-H_Rosette_cDNA_P−1.429425437−1
816112321174158001220001459At_50mM_NH4NO3_L-to-H_P−2.78961071−1
81611232117419239108473At_Drought_Flowers_cDNA_P1.7089257991+
816112321174158001220000437At_Drought_P4.8220277741+
816112321174158001220001247At_Far-red-induction_P−4.212204824−1
816112321174158001220001248At_Far-red-induction_P6.1699997571+
816112321174158001220001450At_Far-red-induction_P1.7632810941+
816112321174158001220001451At_Far-red-induction_P1.3950852281+
816112321174158001220000179At_Germinating_Seeds_P−1.441537409−1
816112321174158001220000180At_Germinating_Seeds_P−3.147732829−1
81611232117419239108461At_Germinating_Seeds_cDNA_P−1.646872266−1
81611232117419239108462At_Germinating_Seeds_cDNA_P−1.665185357−1
81611232117419239108463At_Germinating_Seeds_cDNA_P−1.426993122−1
81611232117419239108464At_Germinating_Seeds_cDNA_P−1.828990435−1
816112321174158001220000495At_Guard_Cells_P−2.920579386−1
8161123211741923920000570At_Guard_Cells_cDNA_P−1.49484136−1
81611232117419239107881At_Herbicide_v2_cDNA_P−1.761216284−1
81611232117419239107891At_Herbicide_v2_cDNA_P−2.164326634−1
81611232117419239108465At_Herbicide_v3_1_cDNA_P4.5574947141+
81611232117419239108629At_Herbicide_v3_1_cDNA_P1.9983656251+
81611232117419239108594At_Ler-rhl_Root_cDNA_P1.1968059151+
816112321174158001220000264At_Open_Flower_P−3.159834613−1
816112321174158001220000265At_Open_Flower_P−2.481345749−1
816112321174158001220000286At_Open_Flower_P−2.087635814−1
816112321174158001220000794At_Petals_P−1.300481698−1
81611232117419239108434At_Root_Tips_cDNA_P−2.458487785−1
816112321174158001220000185At_Roots_P−5.279075251−1
816112321174158001220000439At_Roots_P−5.030661468−1
81611232117419239108480At_Shoot_Apices_cDNA_P−2.309034231−1
81611232117419239108481At_Shoot_Apices_cDNA_P−1.817142133−1
816112321174158001220000184At_Shoots_P−5.762449008−1
816112321174158001220000438At_Shoots_P−5.999883819−1
816112321174158001220000234At_Siliques_P−3.209042334−1
816112321174158001220000235At_Siliques_P−3.022090865−1
816112321174158001220000236At_Siliques_P−2.340846461−1
81611232117419239108435At_stm_Mutants_cDNA_P−2.665998172−1
81611232117419239108437At_Tissue_Specific_Expression_cDNA_P−1.916511208−1
81611232117419239108438At_Tissue_Specific_Expression_cDNA_P−1.518965097−1
849013491409158081020000527At_10%_PEG_P1.5549164761+
8490134914091923720000070At_100uM_ABA_Mutants_cDNA_P5.0666685741+
8490134914091923720000072At_100uM_ABA_Mutants_cDNA_P4.6403923361+
8490134914091923720000086At_100uM_ABA_Mutants_cDNA_P3.7981805771+
8490134914091923720000087At_100uM_ABA_Mutants_cDNA_P3.4251321931+
8490134914091923720000088At_100uM_ABA_Mutants_cDNA_P3.2713555711+
849013491409158081020000573At_100uM_ABA_Mutants_P1.4338537891+
849013491409158081020000441At_1uM_BR-BRZ_P−3.010706617−1
849013491409158081020000443At_1uM_BR-BRZ_P−2.748840687−1
8490134914091923720000090At_2mM_SA_CS3726-Columbia_cDNA_P3.6003729051+
8490134914091923720000111At_42deg_Heat_cDNA_P−2.04796601−1
849013491409158081020000171At_42deg_Heat_P1.5141398091+
849013491409158081020000173At_42deg_Heat_P−1.71925392−1
849013491409158081020000213At_4deg_Cold_P2.8136288041+
849013491409158081020001459At_50mM_NH4NO3_L-to-H_P−1.715098188−1
84901349140919237108473At_Drought_Flowers_cDNA_P1.2149714981+
849013491409158081020000437At_Drought_P4.2202272811+
8490134914091923720000636At_Drought_cDNA_P1.7076348381+
849013491409158081020001247At_Far-red-induction_P−4.634953394−1
849013491409158081020001248At_Far-red-induction_P5.5925988251+
849013491409158081020001450At_Far-red-induction_P1.6499153151+
849013491409158081020000180At_Germinating_Seeds_P−2.680555133−1
84901349140919237108461At_Germinating_Seeds_cDNA_P−2.458568535−1
84901349140919237108462At_Germinating_Seeds_cDNA_P−2.330805635−1
84901349140919237108463At_Germinating_Seeds_cDNA_P−2.324720192−1
84901349140919237108464At_Germinating_Seeds_cDNA_P−2.37426655−1
849013491409158081020000495At_Guard_Cells_P−3.247865708−1
84901349140919237107881At_Herbicide_v2_cDNA_P−3.271686652−1
84901349140919237107891At_Herbicide_v2_cDNA_P−2.602710336−1
84901349140919237108465At_Herbicide_v3_1_cDNA_P4.9042328071+
84901349140919237108629At_Herbicide_v3_1_cDNA_P1.9450475451+
84901349140919237108630At_Herbicide_v3_1_cDNA_P1.4210057021+
849013491409158081020000264At_Open_Flower_P−2.752089532−1
84901349140919237108434At_Root_Tips_cDNA_P−2.359223661−1
849013491409158081020000185At_Roots_P−4.966099796−1
849013491409158081020000439At_Roots_P−4.736820319−1
84901349140919237108480At_Shoot_Apices_cDNA_P−2.408359482−1
84901349140919237108481At_Shoot_Apices_cDNA_P−3.133713759−1
849013491409158081020000438At_Shoots_P−4.72150623−1
849013491409158081020000234At_Siliques_P−2.874162085−1
849013491409158081020000235At_Siliques_P−2.246390758−1
849013491409158081020000236At_Siliques_P−2.46053553−1
84901349140919237108435At_stm_Mutants_cDNA_P−2.551559281−1
84901349140919237108429At_Tissue_Specific_Expression_cDNA_P−1.022462895−1
84901349140919237108437At_Tissue_Specific_Expression_cDNA_P−1.501818945−1
84901349140919237108438At_Tissue_Specific_Expression_cDNA_P−1.739999423−1
84901349140919237108439At_Tissue_Specific_Expression_cDNA_P−2.657664047−1
30546312355477160979120000478Zm_5mM_SA_P1.6265355851+
30548312355477160979120000629Zm_Herbicide-Treatments_P1.0588944781+
30546312355477160979120000493Zm_Hybrid_Seed_Dev_P1.9876524221+
305463123554771609791108543Zm_Imbibed_Embryo_Endosperm_P−1.733891996−1
305463123554771609791108528Zm_Imbibed_Seeds_P1.6082018641+
305463123554771609791108530Zm_Imbibed_Seeds_P1.269903351+
305463123554771609791108546Zm_Imbibed_Seeds_P1.4605006361+
48603312436299160810920000530Zm_2-4D_P1.2657658891+
486033124362991608109108523Zm_42deg_Heat_P−1.154793559−1
486033124362991608109108687Zm_Embryos-Flowers_P1.6915124981+
486033124362991608109108688Zm_Embryos-Flowers_P−2.071866621−1

Claims

1. An isolated nucleic acid molecule comprising:

a) a nucleic acid having a nucleotide sequence which encodes an amino acid sequence exhibiting at least 85% sequence identity to an amino acid sequence according to any one of SEQ ID NOS. 3, 5, 7, 10, 12, 14, 17, 19, 21, 24, 26, 28, 31, 34, 36, 38, 41, 43, 45, 48 and 49;

b) a nucleic acid which is a complement of a nucleotide sequence according to paragraph (a);

c) a nucleic acid which is the reverse of the nucleotide sequence according to subparagraph (a), such that the reverse nucleotide sequence has a sequence order which is the reverse of the sequence order of the nucleotide sequence according to subparagraph (a); or

d) a nucleic acid capable of hybridising to a nucleic acid according to any one of paragraphs (a)-(c), under conditions that permit formation of a nucleic acid duplex at a temperature from about 40° C. and 48° C. below the melting temperature of the nucleic acid duplex.

2. The isolated nucleic acid molecule according to claim 1, which has the sequence according to any one of SEQ ID NOS. 1, 2, 4, 6, 8, 9, 11, 13, 15, 16, 18, 20, 22, 23, 35, 27, 29, 30, 32, 33, 35, 37, 39, 40, 42, 44 and 46.

3. The isolated nucleic acid molecule according to claim 1, wherein said amino acid sequence comprises the sequence according to SEQ ID NOS. 3, 5, 7, 10, 12, 14, 17, 19, 21, 24, 26, 28, 31, 34, 36, 38, 41, 43, 45, 48 and 49.

4. The isolated nucleic acid molecule of claim 1, wherein said amino acid has the structure according to SEQ ID NO. 48 or 49.

5. A vector construct comprising:

a) a first nucleic acid having a regulatory sequence capable of causing transcription and/or translation in a plant; and

b) a second nucleic acid having the sequence of the isolated nucleic acid molecule according to claim 1;

wherein said first and second nucleic acids are operably linked and

wherein said second nucleic acid is heterologous to any element in said vector construct.

6. The vector construct according to claim 5, wherein said first nucleic acid is native to said second nucleic acid.

7. The vector construct according to claim 5, wherein said first nucleic acid is heterologous to said second nucleic acid.

8. A host cell comprising an isolated nucleic acid molecule according to claim 1, wherein said nucleic acid molecule is flanked by exogenous sequence.

9. A host cell comprising a vector construct according to claim 5.

10. An isolated polypeptide comprising an amino acid sequence exhibiting at least 85% sequence identity of an amino acid sequence according to any one of SEQ ID Nos. 3, 5, 7, 10, 12, 14, 17, 19, 21, 24, 26, 28, 31, 34, 36, 38, 41, 43, 45, 48 and 49, and capable of causing a plant to have an increased size or an increased number and size of rosette leaves as compared to a wild type-plant.

11. A method of introducing an isolated nucleic acid into a host cell comprising:

a) providing an isolated nucleic acid molecule according to claim 1; and

b) contacting said isolated nucleic with said host cell under conditions that permit insertion of said nucleic acid into said host cell.

12. A method of transforming a host cell which comprises contacting a host cell with a vector construct according to claim 5.

13. A method of modulating the flowering time or size of a plant, or the size or number of rosette leaves of a plant comprising transforming said plant with a nucleic acid molecule according to claim 1 or a vector according to claim 5.

14. A method of increasing the size of a plant comprising transforming said plant with a nucleic acid molecule according to claim 1 or a vector according to claim 5.

15. A method of increasing the size or number of rosette leaves of a plant comprising transforming said plant with a nucleic acid molecule according to claim 1 or a vector according to claim 5.

16. A method for increasing the size of a plant, or the size or number of rosette leaves, comprising transforming a plant with a nucleic acid molecule that codes for a polypeptide according to SEQ ID NO. 48 or 49.

17. A method for detecting a nucleic acid in a sample which comprises:

a) providing an isolated nucleic acid molecule according to claim 1;

b) contacting said isolated nucleic acid molecule with a sample under conditions which permit a comparison of the sequence of said isolated nucleic acid molecule with the sequence of DNA in said sample; and

c) analyzing the result of said comparison.

18. A plant, plant cell, plant material or seed of a plant which comprises a nucleic acid molecule according to claim 1 which is exogenous or heterologous to said plant or plant cell.

19. A plant, plant cell, plant material or seed of a plant which comprises a vector construct according to claim 5.

20. A plant which has been regenerated from a plant cell or seed according to claim 18.