US20250369978A1

POLYPEPTIDE CLEAVING REAGENTS AND USES THEREOF

Publication

Country:US
Doc Number:20250369978
Kind:A1
Date:2025-12-04

Application

Country:US
Doc Number:19009859
Date:2025-01-03

Classifications

IPC Classifications

G01N33/68C12N9/48C12Q1/37G01N30/88

CPC Classifications

G01N33/6824C12N9/485C12Q1/37G01N30/88C07K2319/21C12Y304/11G01N2030/8831G01N2333/948

Applicants

Quantum-Si Incorporated

Inventors

Manjula Pandey, Brian Reed

Abstract

There is provided amino acid cleaving reagents with improved cleavage activity, allowing for more structural information to be obtained from polypeptides in sequencing reactions.

Ask AI about this patent

Get a summary, plain-language explanation, or ask your own question.

Figures

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001]This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Patent Application No. 63/618,082, filed Jan. 5, 2024, which is hereby incorporated by reference in its entirety.

REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0002]The contents of the electronic sequence listing (R070870174US01-SEQ-JIB.xml; Size: 346,673 bytes; and Date of Creation: Jan. 2, 2025) is herein incorporated by reference in its entirety.

BACKGROUND

[0003]Proteins are the main structural and functional components of cells, driving key biological and cellular processes. Next-generation DNA sequencing technologies have revolutionized our understanding of heredity and gene regulation, but the complex and dynamic states of cells are not fully captured by the genome and transcriptome. Applying similar approaches to proteomics has been difficult because of the scale, dynamic range, and inability to amplify the source.

SUMMARY

[0004]In some aspects, the disclosure provides a composition comprising a cleaving reagent that comprises an aminopeptidase from Streptomyces griseus and a tag sequence. In some embodiments, the aminopeptidase is a catalytic domain of a Streptomyces griseus aminopeptidase. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 101. In some embodiments, the cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 102.

[0005]In some embodiments, the amino acid sequence of the aminopeptidase comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101.

[0006]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to G201 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, and G201Y. In some embodiments, the amino acid substitution is G201V. In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to E198 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from E198L, E198N, E198Q, E198S, E198T, and E198V. In some embodiments, the amino acid substitution is E198V. In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from F221D, F221M, F221N, F221 W, and F221Y. In some embodiments, the amino acid substitution is F221N.

[0007]In some embodiments, the amino acid sequence of the aminopeptidase comprises amino acid substitutions at positions corresponding to E198, G201, and F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitutions comprise E198V, G201V, and F221N. In some embodiments, the amino acid sequence comprises one or more amino acid substitutions selected from M163F, M163I, M163L, M163Y, E200Q, D202N, A224F, A224I, A224L, and A224V.

[0008]In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143. In some embodiments, the amino acid sequence is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109 or 124.

[0009]In some embodiments, the cleaving reagent is present at a concentration of between about 0.01 μM and about 10 μM, between about 0.01 μM and about 5 μM, between about 0.01 μM and about 1 μM, between about 0.05 μM and about 0.5 μM, between about 0.1 μM and about 25 μM, between about 0.5 μM and about 20 μM, or between about 1 μM and about 10 μM.

[0010]In some embodiments, the cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes, between about 5 and about 50 minutes, between about 5 and 30 minutes, between about 5 and 20 minutes, between about 5 and 15 minutes, or between about 5 and 10 minutes, where the N-terminal amino acid comprises a hydrophobic side chain, a polar uncharged side chain, or a negatively charged side chain.

[0011]In some embodiments, the tag sequence is attached to the C-terminus of the aminopeptidase. In some embodiments, the tag sequence comprises at least two amino acids. In some embodiments, the tag sequence comprises between about 2 and about 200 amino acids. In some embodiments, the tag sequence comprises a polyhistidine-tag. In some embodiments, the tag sequence comprises a biotinylation tag. In some embodiments, the biotinylation tag comprises at least one biotin ligase recognition sequence. In some embodiments, the biotinylation tag comprises two biotin ligase recognition sequences oriented in tandem. In some embodiments, the tag sequence has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to any one of SEQ ID NOs: 32-45. In some embodiments, the tag sequence has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 43.

[0012]In some aspects, the disclosure provides a composition comprising an aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 101, where the amino acid sequence comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101.

[0013]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to G201 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, and G201Y. In some embodiments, the amino acid substitution is G201V. In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to E198 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from E198L, E198N, E198Q, E198S, E198T, and E198V. In some embodiments, the amino acid substitution is E198V. In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from F221D, F221M, F221N, F221 W, and F221Y. In some embodiments, the amino acid substitution is F221N.

[0014]In some embodiments, the amino acid sequence of the aminopeptidase comprises amino acid substitutions at positions corresponding to E198, G201, and F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitutions comprise E198V, G201V, and F221N. In some embodiments, the amino acid sequence comprises one or more amino acid substitutions selected from M163F, M163I, M163L, M163Y, E200Q, D202N, A224F, A224I, A224L, and A224V.

[0015]In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143. In some embodiments, the amino acid sequence is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109 or 124.

[0016]In some aspects, the disclosure provides a composition comprising: a first cleaving reagent comprising a first aminopeptidase from Pyrococcus horikoshii; and a second cleaving reagent comprising a second aminopeptidase from Streptomyces griseus.

[0017]In some embodiments, the amino acid sequences of the first and second aminopeptidases share less than 80% sequence identity (e.g., less than 70%, less than 60%, less than 50%, 10-80%, 20-60%, 30-50%, or 40-50% sequence identity). In some embodiments, the first aminopeptidase has an amino acid sequence that is at least 80% identical to SEQ ID NO: 3. In some embodiments, the second aminopeptidase has an amino acid sequence that is at least 80% identical to SEQ ID NO: 101. In some embodiments, the amino acid sequence of the second aminopeptidase comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101, as described herein.

[0018]In some embodiments, the first cleaving reagent comprises a first tag sequence. In some embodiments, the second cleaving reagent comprises a second tag sequence. In some embodiments, the composition further comprises a third cleaving reagent comprising an aminopeptidase from Yersinia pestis. In some embodiments, the third cleaving reagent comprises an aminopeptidase having specific activity towards N-terminal X-P dipeptide motifs (where X is an N-terminal amino acid, and P is proline).

[0019]In some aspects, the disclosure provides a composition comprising: a first cleaving reagent comprising a first aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 3; a second cleaving reagent comprising a second aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 101; and optionally, a third cleaving reagent comprising a third aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 5 or 7. In some embodiments, the amino acid sequence of the second aminopeptidase comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101, as described herein.

[0020]In some embodiments, the first cleaving reagent comprises a first tag sequence; the second cleaving reagent comprises a second tag sequence; and the third cleaving reagent comprises a third tag sequence. In some embodiments, the first tag sequence is attached to a terminal end of the first aminopeptidase; the second tag sequence is attached to a terminal end of the second aminopeptidase; and the third tag sequence is attached to a terminal end of the third aminopeptidase. In some embodiments, each tag sequence is attached to the C-terminus of its respective aminopeptidase. In some embodiments, each tag sequence independently comprises at least two amino acids (e.g., 2-200, 2-100, 4-80, 5-50, 5-30, 5-20, 10-100, 20-80, 30-70 amino acids).

[0021]In some embodiments, at least one of the first, second, and third tag sequences comprises a polyhistidine-tag. In some embodiments, at least one of the first, second, and third tag sequences comprises a biotinylation tag. In some embodiments, the biotinylation tag comprises at least one biotin ligase recognition sequence. In some embodiments, the biotinylation tag comprises two biotin ligase recognition sequences oriented in tandem.

[0022]In some embodiments, the first, second, and third cleaving reagents are present in the composition at a first, second, and third concentration, respectively, where the first concentration is at least two-fold higher than the second concentration. In some embodiments, the first concentration is at least five-fold higher than the third concentration. In some embodiments, the second concentration is at least two-fold higher than the third concentration. In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 10:1 and about 500:1, between about 50:1 and about 500:1, between about 100:1 and about 500:1, between about 200:1 and about 400:1, or between about 2:1 and about 20:1. In some embodiments, the molar ratio of the first cleaving reagent to the third cleaving reagent in the composition is between about 5:1 and about 200:1.

[0023]In some embodiments, the first cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 4. In some embodiments, the second cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 102. In some embodiments, the third cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% identical to SEQ ID NO: 8.

[0024]In some aspects, the disclosure provides reaction mixtures for polypeptide analysis. In some embodiments, a reaction mixture comprises: a composition described herein; and one or more amino acid binding proteins not having peptide cleavage activity. In some embodiments, a reaction mixture comprises: a cleaving reagent comprising an aminopeptidase having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 101 or 102; and one or more amino acid binding proteins not having peptide cleavage activity. In some embodiments, a reaction mixture comprises: a cleaving reagent comprising a first aminopeptidase having an amino acid sequence that is at least 92% (e.g., 92-99%, 94-100%, 96-100%, 98-100%) identical to SEQ ID NO: 3 and comprising a first tag sequence; and one or more amino acid binding proteins not having peptide cleavage activity.

[0025]In some aspects, the disclosure provides a kit comprising one or more cleaving reagents (e.g., aminopeptidases) described herein. In some embodiments, a kit comprises one or more cleaving reagents comprising an aminopeptidase having an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from Table 1. In some embodiments, the kit further comprises one or more amino acid recognizers (e.g., one or more amino acid binding proteins not having peptide cleavage activity). In some embodiments, the kit further comprises instructions for using the kit in a method of polypeptide analysis.

[0026]In some aspects, the disclosure provides methods of polypeptide analysis. In some embodiments, a method of polypeptide analysis comprises: contacting a polypeptide with a reaction mixture described herein; monitoring a signal for signal pulses corresponding to interactions between one or more amino acid binding proteins and the polypeptide; and determining at least one chemical characteristic of the polypeptide based on a characteristic pattern in the signal.

[0027]In some aspects, the disclosure provides methods of analysis of multiple polypeptides. In some embodiments, a method of analysis of multiple polypeptides comprises: (a) loading the multiple polypeptides in a plurality of sample wells; (b) contacting the multiple polypeptides with a composition comprising an aminopeptidase to induce cleavage of a terminal amino acid of a plurality of the multiple polypeptides; (c) monitoring a signal for signal pulses corresponding to interactions between one or more amino acid binding proteins and the multiple polypeptides; and (d) repeating steps (b) and (c). In some embodiments, in between each pair of successive repetitions of step (b) for a respective sample well, the monitoring a signal of step (c) results in signal pulse data corresponding to interactions between one or more amino acid binding proteins and a polypeptide of the multiple polypeptides that is loaded in the respective sample well, in at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the plurality of sample wells. In some embodiments, the composition comprising the aminopeptidase comprises a reaction mixture described herein.

[0028]In some aspects, the disclosure provides a system comprising: at least one hardware processor; and at least one non-transitory computer-readable storage medium storing processor-executable instructions that, when executed by the at least one hardware processor, cause the at least one hardware processor to perform a method described herein. In some aspects, the disclosure provides at least one non-transitory computer-readable storage medium storing processor-executable instructions that, when executed by at least one hardware processor, cause the at least one hardware processor to perform a method described herein.

[0029]The details of certain embodiments of the disclosure are set forth in the Detailed Description. Other features, objects, and advantages of the disclosure will be apparent from the Examples, Drawings, and Claims.

BRIEF DESCRIPTION OF THE DRAWINGS

[0030]The accompanying Drawings, which constitute a part of this specification, illustrate several embodiments of the disclosure and together with the accompanying description, serve to explain the principles of the disclosure.

[0031]FIG. 1A shows an example overview of real-time dynamic protein sequencing. Protein samples are digested into peptide fragments, immobilized in nanoscale reaction chambers, and incubated with a mixture of freely-diffusing N-terminal amino acid (NAA) recognizers and aminopeptidases that carry out the sequencing process. The labeled recognizers bind on and off to the peptide when one of their cognate NAAs is exposed at the N-terminus, thereby producing characteristic pulsing patterns. The NAA is cleaved by an aminopeptidase, exposing the next amino acid for recognition. The temporal order of NAA recognition and the kinetics of binding enable peptide identification and are sensitive to features that modulate binding kinetics, such as post-translational modifications (PTMs).

[0032]FIG. 1B shows an example schematic of a pixel of an integrated device.

[0033]FIGS. 2A-2D show example results illustrating TET aminopeptidase performance improvement by extending the C terminal of the peptide with DDD motif. The bar charts in FIGS. 2A-2D show cut depth (FIG. 2A), cleavage activity (% of reads reaching the last visible RS) (FIG. 2B), time taken to cleave DQQ motif and R residue (FIG. 2C), and % of 4+RSs (FIG. 2D).

[0034]FIGS. 3A-3B show example results from AP30 expression and purification. FIG. 3A shows an example chromatogram showing AP30 separation and the eluted peak. FIG. 3B shows Talon affinity column purification fractions resolved on SDS PAGE gel to show AP30 enrichment (left image), and the native gel showing hTETII and AP30 protein profiles before and after conditioning (right image).

[0035]FIG. 4 shows three bar charts comparing the inherent cleavage rates and substrate specificities by hTETII and AP30 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart).

[0036]FIGS. 5A-5C show example results from a protein sequencing assay with AP30 cutter (5 μM), PS610 (50 nM) recognizer and QP47 peptide (FAAAYPDDD) (SEQ ID NO: 46). FIG. 5A shows a representative trace showing the first RS and the last RS recognition by PS610 as the cleavage progressed. FIG. 5B shows plots showing the mean cleavage times for FA (left plot) and YP (right plot) RSs. FIG. 5C shows a plot showing the rapid sequential cleavage population and regular cleavage population.

[0037]FIGS. 6A-6C show example results from a protein sequencing assay with 1 μM hTETII cutter, PS610 (50 nM) recognizer and QP47 peptide (FAAAYPDDD) (SEQ ID NO: 46). FIG. 6A shows a representative trace showing the first and the last RSs by PS610 as the cleavage progressed. FIG. 6B shows plots showing the mean cleavage times for FA and YP RSs. FIG. 6C shows a plot showing the rapid sequential cleavage population and regular cleavage population.

[0038]FIGS. 7A-7B show example results from a protein sequencing assay with AP30 (1 μM)/PfuTET (40 μM), along with PS610 (50 nM), PS557 (250 nM) and PS621 (250 nM) recognizers and QP433 peptide (RLIFAYPDDD) (SEQ ID NO: 47). FIG. 7A shows a representative trace showing the five RSs identified by the recognizers as the cleavage progressed. FIG. 7B shows a Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs (top plot), and plots showing the cut depths and proportion of each RS recognized in the reads with (middle plot) and without (bottom plot) gap (no missed recognizable residue). FIG. 7A also shows SEQ ID NO: 54.

[0039]FIGS. 8A-8B show example results from a protein sequencing assay with AP30 (3 PM) or hTETII (2 μM)/PfuTET (40 μM) aminopeptidase combination, along with PS610 (50 nM) and PS557 (250 nM) recognizers and QP425 (LASSIAEANRFADIADYP) (SEQ ID NO: 48) on the same chip. FIG. 8A shows representative traces for reactions with AP30 and hTETII showing RSs identified by the recognizers as the cleavage progressed. FIG. 8B shows plots showing cut depths and proportions of each RS recognized in the reads without gap (no missed recognizable residue).

[0040]FIGS. 9A-9C show example results illustrating that AP30 improved cutting performance by increasing cleavage activity and reducing rapid sequential cleavage. The bar charts in FIGS. 9A-9C show cut depth (FIG. 9A), % of 4+RSs reads (FIG. 9B), and rapid sequential cleavage of IA and FA RSs (FIG. 9C).

[0041]FIGS. 10A-10B show example results from AP37 expression and purification. FIG. 10A shows an example chromatogram showing AP37 enrichment and the eluted peak. FIG. 10B shows talon affinity column purification fractions resolved on SDS PAGE gel to show AP37 separation.

[0042]FIG. 11 shows three bar charts comparing the inherent cleavage rates and substrate specificities by PfuTET and AP37 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart).

[0043]FIGS. 12A-12B show example results from a protein sequencing assay with AP37 (40 μM) or PfuTET (40 μM) aminopeptidase, along with PS610 (50 nM), PS961 (250 nM), PS961 (250 nM) recognizers and QP514 (DQQRLIFAYPDDD) (SEQ ID NO: 49) on separate chips.

[0044]FIG. 12A shows representative traces for reaction with AP37 or PfuTET showing RSs identified by the recognizers as the cleavage progressed. FIG. 12B shows plots showing cut depths and proportions of each RS recognized in the reads without gap (no missed recognizable residue).

[0045]FIGS. 13A-13C show example results from a protein sequencing assay performed at two different AP37 concentrations (20 μM/40 μM), 4 μM hTETII, and PS610 (50 nM), PS557 (250 nM) and PS691 (100 nM) recognizers on QP433 (RLIFAYPDDD) (SEQ ID NO: 47). FIG. 13A shows the improvements in cut depth. FIG. 13B shows improvements in % of important reads.

[0046]FIG. 13C shows that AP37 reduced rapid sequential cleavage (RSC) of LI, IF, and FA RSs.

[0047]FIGS. 14A-14B show example results illustrating the effect of different AP30/AP37 proportions with PS610 (50 nM), PS691 (100 nM), and PS961 (250 nM) recognizers, on time to cleave DQQ motif and R residue (FIG. 14A) and RS rapid sequential cleavage (FIG. 14B).

[0048]FIGS. 15A-15B show bar charts showing the distribution of the performance metrics (cut depth, % of 4+RSs reads, and % of 5 RSs reads) with the recognizers mix of PS610 (50 nM), PS961 (250 nM), and PS691 (100 nM), and AP30/AP37 at 4 μM/40 μM on QP514 (DQQRLIFAYPDDD) (SEQ ID NO: 49) (FIG. 15A) and at 10 μM/60 μM concentration on QP549 (DQQIASSRLAASFAAQQYPDDD) (SEQ ID NO: 50) (FIG. 15B).

[0049]FIG. 16 shows reads breakdown and abundance of ungapped reads, with single deletion allowed in reads of length of 4, obtained from one of the chip runs by the recognizers and aminopeptidases mix of PS961/PS691 at 250/100 nM and AP30/hTETIII at 10/60 PM, on QP549.

[0050]FIGS. 17A-17B show example results from yPIP expression and purification. FIG. 17A shows an example chromatogram showing yPIP separation and the eluted peak. FIG. 17B shows Talon affinity column purification fractions resolved on SDS PAGE gel to show yPIP enrichment.

[0051]FIGS. 18A-18B show representative traces showing the effect of adding yPIP (2 μm) in the AP30/AP37 (4/40 μM) aminopeptidase combination in a protein sequencing assay. SEQ ID NO: 55 is shown throughout the figures.

[0052]FIGS. 19A-19B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (2 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0053]FIGS. 20A-20B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (2 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0054]FIGS. 21A-21B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP (0.5 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (1 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM) recognizers.

[0055]FIGS. 22A-22B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP (0.5 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (1 μM) combinations along with PS610 (50 nM)/PS961 (125 nM) recognizers combinations along with PS610 (50 nM)/PS961 (125 nM) recognizers.

[0056]FIGS. 23A-23B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP-BC_B1 (2 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP-470 (2 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0057]FIGS. 24A-24B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP-BC_B1 (2 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP-470 (2 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0058]FIGS. 25A-25B show (A) yPIP (SEQ ID NO: 6) and AP70 (SEQ ID NO: 8) protein amino acid sequence alignment showing the C terminal 6×H tag (SEQ ID NO: 32) and GGS-6× His-tag (SEQ ID NO: 33), respectively, and (B) expression constructs for yPIP and AP70 with molecular weights of the proteins.

[0059]FIGS. 26A-26B show example results from AP70 expression and purification. FIG. 26A shows an example chromatogram showing AP70 separation and the eluted peak. FIG. 26B shows talon affinity column purification fractions resolved on SDS PAGE gel to show AP70 enrichment.

[0060]FIGS. 27A-27D show example results from HPLC assays for QP734 (FPARAFAYPDDD) (SEQ ID NO: 52) peptide cleavage by AP70 at 10 μM (FIG. 27A), 5 μM (FIG. 27B), 1 μM (FIG. 27C), or 0.25 μM (FIG. 27D) after different conditioning treatments and unconditioned control.

[0061]FIGS. 28A-28D show example results from HPLC assays for different peptide cleavage by AP30 (FIG. 28A) or AP70 (FIGS. 28B-28D) after different conditioning treatments and unconditioned control.

[0062]FIG. 29 shows example results comparing the cleavage activity and substrate specificities for AP70, AP30+AP37, and AP30+AP37+AP70 combinations on PXX, XPP, XPX peptides containing proline.

[0063]FIG. 30 shows example results from protein sequencing assay with AP70 (1 PM, 4 PM), no AP control, AP30 (4 μM) on QP734 (FPARAFAYPDDD) (SEQ ID NO: 52) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0064]FIGS. 31A-31B show representative traces from protein sequencing assays showing the effect of adding AP70 (1 μm) in the AP30/AP37 (4/40 μM) aminopeptidase combination.

[0065]FIGS. 32A-32F show example results from AP70 concentration titration to optimize the AP30+AP37+AP70 AP combination performance on chips for QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) sequencing.

[0066]FIGS. 33A-33B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0067]FIGS. 34A-34B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM) and (B) AP30 (4 μM)/AP37 (40 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0068]FIGS. 35A-35B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations on QP354 (LAAYPARLAYPDDDF) (SEQ ID NO: 53) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0069]FIGS. 36A-36B show reads proportion breakdown for the QP354 (LAAYPARLAYPDDDF) (SEQ ID NO: 53) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0070]FIGS. 37A-37B show example results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 BC-B1 batch (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP BC-B1 batch (1 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0071]FIGS. 38A-38B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 BC-B1 batch (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP BC-B1 batch (1 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0072]FIG. 39A shows example sequencing runs illustrating potential areas of improvement for aminopeptidases.

[0073]FIG. 39B shows a model for a dodecameric aminopeptidase (AP) assembly process (left); the dodecameric complex with three active sites (middle); and Rapid Sequential Cleavage demonstrated by the dodecameric AP (right) due to multiple active sites in close vicinity: sequencing of QP47 (FAAAYPDDD (SEQ ID NO: 46)) showed fast transition from FA to YP (red peak at left) via dark amino acids (AAA motif) in this run with PS610 recognizer.

[0074]FIGS. 40A-40E show results from characterization of a monomeric aminopeptidase (“AP64”). FIG. 40A shows an example crystal structure of a monomeric aminopeptidase from Streptomyces griseus. FIG. 40B shows Talon affinity column purification fractions resolved on SDS PAGE gel to show AP64 enrichment (the eluted peak fractions with purified monomer (35 kDa)). FIG. 40C shows example results from HPLC assay chromatogram for cleavage by AP64 and AP30 under same conditions on various peptides with distinct N-terminal amino acids. FIG. 40D shows three bar charts comparing the inherent cleavage rates and substrate specificities by AP64 and AP30 for 18 individual amino acids categorized as per the activity level (high activity: left chart; moderate activity: middle chart; very low activity: right chart). FIG. 40E shows three bar charts comparing the inherent cleavage rates and substrate specificities by AP64, AP30 and AP37 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart). For the results shown in FIGS. 40D-40E, inherent cleavage rates were derived for each residue at an optimal concentration of aminopeptidase determined by aminopeptidase titration, and rates were calculated by exponential fits of the intensity change of the time course.

[0075]FIGS. 41A-41D show results from on chip findings and validation for aminopeptidase combinations in 5-recognizer runs. FIG. 41A shows the sequencing kinetics for peptide QP1027 (RLAIQFAYPDDD (SEQ ID NO: 170)) in protein sequencing assay: AP30 (3 M)/AP37 (30 μM) (Left) vs. AP64 (0.1 M)/AP37 (30 μM) (Right) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. FIG. 41B shows the sequencing kinetics for peptide QP1160 (FLARQAIWAQDDDK (SEQ ID NO: 172)) in protein sequencing assay: AP30 (3 M)/AP37 (30 μM) (Left) vs. AP64 (0.1 M)/AP37 (30 μM) (Right) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. FIG. 41C shows the sequencing kinetics for peptide QP586 (FAQLQARFAADDD (SEQ ID NO: 173)) in protein sequencing assay: AP30 (3 M)/AP37 (30 μM) (Left) vs. AP64 (0.1 M)/AP37 (30 μM) (Right) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. In FIGS. 41A-41C, kinetic parameters are listed at the top and the respective sequencing traces are shown below for each side of sequencing run on the chip. FIG. 41D shows a bar graph showing the % aligned reads/1k active apertures using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37, demonstrating improvements in alignments using AP64. Three synthetic peptides were used (QP1027, QP1160, QP586), 4 replicates per peptide. Error bars denote standard deviation; QP1027 (RLAIQFAYPDDD (SEQ ID NO: 170)), QP1160 (FLARQAIWAQDDDK (SEQ ID NO: 172)) and QP586 (FAQLQARFAADDD (SEQ ID NO: 173)) peptides sequenced in protein sequencing assay: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 M) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers.

[0076]FIGS. 42A-42S show results from polypeptide sequencing runs using aminopeptidase combinations with AP64 for sequencing different protein libraries, including a CDNF human protein library (FIGS. 42A-42C), a PDL1 human protein library (FIGS. 42D-42F), and an HSA protein library (FIGS. 42G-42I). FIG. 42J shows results for 9 individual libraries used in the study. FIGS. 42K-42S show amino acid sequences of 9 individual proteins used in the study that provided the results shown in FIGS. 42A-42J: CDNF (FIG. 42K), PDL1 (FIG. 42L), MAPK3 (FIG. 42M), GFAP (FIG. 42N), NGAL (FIG. 42O), IL4 (FIG. 42P), VIME (FIG. 42Q), LMNB1 (FIG. 42R), and HSA (FIG. 42S). The numbers in red text denote number of alignment seen for that peptide in the AP64/AP30 runs.

[0077]FIGS. 43A-43C show results from characterization of monomeric aminopeptidase AP103 and AP206 through a real time kinetics assay utilizing the AMC fluorophore-linked short peptides. FIG. 43A shows a comparison of the maximum inherent cleavage rates and relative substrate specificities of AP64, AP103, and AP206 for 19 individual amino acids. FIG. 43B shows the relative substrate specificities and maximum inherent cleavage rates for AP206 (top row), AP64 (middle row), and AP37 (bottom row) categorized as per the activity level (low activity: left chart; moderate activity: middle chart; high activity: right chart). FIG. 43C shows the relative substrate specificities and cleavage rates for AP103 (top row), AP64 (middle row), and AP37 (bottom row) categorized as per the activity level (low activity: left chart; moderate activity: middle chart; high activity: right chart).

[0078]FIGS. 44A-44B show Talon affinity column purification fractions on AKTA (FIG. 44A) resolved in SDS PAGE gel (FIG. 44B) to show AP206 enrichment.

[0079]FIGS. 45A-45B show exemplary results from protein sequencing assays with AP64 (0.1 μM)/AP37 (40 μM) (FIG. 45A) or AP206 (1.5 μM)/AP37 (15 μM) (FIG. 45B) on a six-human protein library mix (comprising CDNF, PDL1, NGAL, IL20, IL18, MAPK3).

[0080]FIG. 46 shows the ratio of alignments from protein sequencing assays with AP206/AP37 relative to alignments from protein sequencing assays with AP64/AP37 on a six-human protein library mix (comprising CDNF, PDL1, NGAL, IL20, IL18, MAPK3).

[0081]FIG. 47 shows the ratio of alignments from protein sequencing assays with AP206/AP37 relative to alignments from protein sequencing assays with AP64/AP37 on 23 peptides identified in the six-human protein library mix (comprising CDNF, PDL1, NGAL, IL20, IL18, MAPK3).

[0082]FIGS. 48A-48E shows the ratios of recognition sequence duration (top left), pulse duration (top right), number of pulses (bottom left), and interpulse duration (bottom right) for 13 individual amino acid for AP206 relative to AP64 (FIG. 48A), on a six-human protein library mix (comprising CDNF, PDL1, NGAL, IL20, IL18, MAPK3) experiments in FIG. 46, and absolute values of all of these parameters for AP206 (FIG. 48B), or AP64 (FIG. 48C). FIG. 48D shows the ratio of AP103/AP64 recognition sequence duration at 13 individual amino acids. FIG. 48E shows the ratio of AP206/AP103 recognition sequence duration at 11 individual amino acids.

[0083]FIGS. 49A-49B show exemplary results from protein sequencing assays with AP64 (0.1 μM)/AP37 (40 μM) (FIG. 49A) or AP206 (1.5 μM)/AP37 (15 μM) (FIG. 49B) on a four-human protein library mix (comprising VIME, RAB11B, SFN, LMNB1).

[0084]FIG. 50 shows the ratio of alignments from protein sequencing assays with AP206/AP37 relative to alignments from protein sequencing assays with AP64/AP37 on a four-human protein library mix (comprising VIME, RAB11B, SFN, LMNB1).

[0085]FIG. 51 shows the ratio of alignments from protein sequencing assays with AP206/AP37 relative to alignments from protein sequencing assays with AP64/AP37 on 17 peptides identified in the four-human protein library mix.

[0086]FIGS. 52A-52D show example sequencing results obtained in sequencing reactions with three-aminopeptidase combination of AP206, AP37, and AP70 with STIP1 human protein library.

[0087]FIGS. 53A-53D show example sequencing results obtained in sequencing reactions with three-aminopeptidase combination of AP206, AP37, and AP70 or AP95 with UBB human protein library.

[0088]FIGS. 54A-54E show crystal structures and structure-based modeling of the recognition sites of aminopeptidases of the disclosure. FIG. 54A shows the recognition pocket of AP64 bound to a leucine substrate. FIG. 54B shows the recognition pocket of AP103 bound to a leucine substrate. FIG. 54C shows the recognition pocket of AP64 bound to a phenylalanine substrate. FIG. 54D shows the recognition pocket of AP206 bound to a leucine substrate. FIG. 54E shows a comparison of recognition pockets without (top) and with (bottom) a valine substitution at residue G201.

[0089]FIGS. 55A-55D show crystal structures of aminopeptidases of the disclosure. FIG. 55A shows the recognition pocket of AP64 bound to a leucine substrate. FIGS. 55B-55D show different views of the leucine-bound recognition pocket of AP64 shown superimposed with the leucine-bound recognition pocket of AP206.

[0090]FIG. 56 shows crystal structures of Streptomyces griseus aminopeptidase bound to N-terminal phenylalanine (top) or leucine (bottom) substrates.

[0091]FIGS. 57A-57H show real time cleavage activities, measured over minutes, of aminopeptidase variants for N-terminal leucine (FIGS. 57A-57D) and N-terminal alanine (FIGS. 57E-H) AMC-labeled peptide substrates at a fixed protein variant concentration. FIG. 57A shows a comparison of leucine cleavage activities measured for AP64 and AP103. FIG. 57B shows a comparison of leucine cleavage activities measured for aminopeptidase variants, illustrating the effects of G201 substitutions. FIG. 57C shows a comparison of leucine cleavage activities measured for aminopeptidase variants, illustrating the effects of M163 substitutions.

[0092]FIG. 57D shows a comparison of leucine cleavage activities measured for aminopeptidase variants, illustrating the effects of A224 substitutions. FIG. 57E shows a comparison of alanine cleavage activities measured for AP64 and AP103. FIG. 57F shows a comparison of alanine cleavage activities measured for aminopeptidase variants, illustrating the effects of G201 substitutions. FIG. 57G shows a comparison of alanine cleavage activities measured for aminopeptidase variants, illustrating the effects of M163 substitutions. FIG. 57H shows a comparison of alanine cleavage activities measured for aminopeptidase variants, illustrating the effects of A224 substitutions.

[0093]FIGS. 58A-58C show example sequencing results obtained in sequencing reactions with AP103 or AP202.

[0094]FIGS. 59A-59C show example sequencing results obtained in sequencing reactions with the combination of AP64/AP37 or AP216/AP37.

DETAILED DESCRIPTION

[0095]Aspects of the disclosure relate to compositions and methods for polypeptide analysis based on single-molecule binding interactions between the polypeptide and one or more reagents described herein. In some embodiments, the disclosure provides cleaving reagents, such as aminopeptidases, having improved performance in peptide sequencing reactions. In some embodiments, cleaving reagents of the disclosure display improvements in cleavage activity toward amino acids of a polypeptide, allowing for more information to be obtained from peptide sequencing reactions.

[0096]For example, FIG. 1A shows an example of a dynamic peptide sequencing reaction in which individual on-off binding events give rise to signal pulses of a signal output. As shown at left, a protein sample may be fragmented into peptides, which are immobilized in reaction chambers and exposed to a mixture of amino acid recognizers and cleaving reagents. As shown at right, amino acid recognizers reversibly bind to the peptide, producing a series of changes in signal output (e.g., signal pulses) as amino acids are progressively cleaved from the peptide terminus. The temporal order of recognition and the kinetics of binding and/or cleaving can be used to determine structural information for the peptide.

[0097]Compositions and methods for performing dynamic peptide sequencing and analyzing data obtained therefrom are described more fully in PCT International Publication No. WO2020/102741A1, filed Nov. 15, 2019, and PCT International Publication No. WO2021/236983A2, filed May 20, 2021, each of which is incorporated by reference in its entirety.

[0098]In some aspects, the disclosure provides cleaving reagents (e.g., aminopeptidases) with improved cleavage activity which can be advantageous in the context of a peptide sequencing reaction. As described herein and illustrated in FIG. 1A, peptide sequencing reactions may be carried out by exposing a polypeptide to a mixture of amino acid recognizers and aminopeptidases, and determining structural information for the polypeptide based on detectable recognition events preceding a cleavage event. In some embodiments, aminopeptidases of the disclosure allow for more information to be obtained from sequencing reactions. For example, in some embodiments, the aminopeptidases display cleavage activity at improved rates for detecting recognition events in between cleavage events (e.g., as shown by a decrease in rapid sequential cleavage). In some embodiments, the sequential cleavage of amino acids by the aminopeptidases progresses further into peptide substrates (e.g., as shown by an increase in cut depth). In some embodiments, the aminopeptidases cleave certain amino acids more efficiently relative to a homologous enzyme.

[0099]The inventors have recognized and appreciated that certain aminopeptidases exhibit fast and non-uniform cleavage kinetics that limit the amount of time within which amino acid recognizers are able to bind and produce signal data with sufficient confidence, resulting in incomplete and/or inaccurate sequencing information. For example, as illustrated in FIG. 39A, in some instances, results from sequencing reactions showed a missing region of interest (ROI) or deletion from the sequencing data. Without wishing to be bound by any particular theory, the missing ROIs observed in these sequencing results were attributed at least in part to the multimeric structure of the aminopeptidase: a dodecameric complex containing three active sites, which could permit rapid sequential cleavage (RSC) resulting from multiple active sites in the vicinity of the terminal end of the peptide.

[0100]The inventors have further recognized and appreciated that certain monomeric aminopeptidases advantageously reduce the occurrence of RSC, and in turn, provide higher accuracy in sequencing by reducing the occurrence of missing ROIs in sequencing data. Moreover, the monomeric aminopeptidase of the disclosure can, in some embodiments, exhibit higher cleavage efficiency, provide higher cut depth due to the relatively smaller size of monomers permitting cleavage up to the end into most peptides, and provide more uniform activity and ease of preparation as compared to multimeric aminopeptidases.

Aminopeptidases

[0101]In some aspects, the disclosure provides a cleaving reagent comprising an aminopeptidase having an amino acid sequence selected from Table 1. It should be appreciated that the example sequences in Table 1 and other examples described herein are meant to be non-limiting, and aminopeptidases in accordance with the disclosure can include any homologs, variants, or fragments thereof minimally containing domains or subdomains responsible for amino acid cleavage.

[0102]In some embodiments, a cleaving reagent comprises an aminopeptidase having an amino acid sequence that is at least 80% identical to an amino acid sequence selected from Table 1. In some embodiments, an aminopeptidase has at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 98%, or higher, amino acid sequence identity to an amino acid sequence selected from Table 1. In some embodiments, an aminopeptidase has 25-50%, 50-60%, 60-70%, 70-80%, 80-90%, 90-95%, 92-99%, 94-99%, 95-99%, 40-100%, 50-100%, 60-100%, 70-100%, 80-100%, 90-100%, 92-100%, 94-100%, 95-100%, 96-100%, or 100% amino acid sequence identity to an amino acid sequence selected from Table 1.

[0103]In some embodiments, a cleaving reagent comprises a synthetic or recombinant aminopeptidase. In some embodiments, a cleaving reagent comprises a monomeric aminopeptidase. In some embodiments, a cleaving reagent comprises a multimeric aminopeptidase (e.g., a multimeric complex of monomeric subunits, which may be the same or different).

[0104]In some embodiments, a cleaving reagent comprises an aminopeptidase obtained or derived from a particular source (e.g., organism). As described herein, in some embodiments, an aminopeptidase identified as being from a particular organism does not impart a requirement that the aminopeptidase have an amino acid sequence that is 100% identical to a naturally-occurring aminopeptidase from the organism, although it may in some embodiments.

[0105]For example, in some embodiments, a cleaving reagent comprises an aminopeptidase from Pyrococcus horikoshii (e.g., Pyrococcus horikoshii TET Aminopeptidase II, Pyrococcus horikoshii TET Aminopeptidase III). In some embodiments, an aminopeptidase from Pyrococcus horikoshii is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a naturally-occurring aminopeptidase from Pyrococcus horikoshii (e.g., Pyrococcus horikoshii TET Aminopeptidase II, Pyrococcus horikoshii TET Aminopeptidase III).

[0106]In some embodiments, a cleaving reagent comprises an aminopeptidase from Streptomyces griseus (e.g., a catalytic domain of a Streptomyces griseus Aminopeptidase). In some embodiments, an aminopeptidase from Streptomyces griseus is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a naturally-occurring aminopeptidase from Streptomyces griseus (e.g., a catalytic domain of a Streptomyces griseus Aminopeptidase).

[0107]In some embodiments, a cleaving reagent comprises an engineered variant of an aminopeptidase from Streptomyces griseus (e.g., a catalytic domain of a Streptomyces griseus Aminopeptidase). In some embodiments, the cleaving reagent comprises an amino acid sequence having one or more amino acid substitutions relative to Streptomyces griseus Aminopeptidase (SEQ ID NO: 101). In some embodiments, the cleaving reagent comprises an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-95%, 85-95%, 90-95%, or 90-98%) identical to SEQ ID NO: 101, where the amino acid sequence comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101.

[0108]In some embodiments, the amino acid substitution is selected from the group consisting of M163F, M163I, M163L, M163Y, E198L, E198N, E198Q, E198S, E198T, E198V, E200Q, G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, G201Y, D202N, F221D, F221M, F221N, F221 W, F221Y, A224F, A224I, A224L, and A224V.

[0109]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to G201 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, and G201Y. In some embodiments, the amino acid substitution is G201V.

[0110]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to E198 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from E198L, E198N, E198Q, E198S, E198T, and E198V. In some embodiments, the amino acid substitution is E198V.

[0111]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from F221D, F221M, F221N, F221 W, and F221Y. In some embodiments, the amino acid substitution is F221N.

[0112]In some embodiments, the amino acid sequence comprises amino acid substitutions at positions corresponding to E198, G201, and F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitutions comprise E198V, G201V, and F221N. In some embodiments, the amino acid sequence comprises one or more amino acid substitutions selected from M163F, M163I, M163L, M163Y, E200Q, D202N, A224F, A224I, A224L, and A224V.

[0113]In some embodiments, the amino acid sequence is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143.

[0114]In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109. In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 146. In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 124. In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 148.

[0115]In some embodiments, a cleaving reagent comprises an aminopeptidase from Yersinia pestis (e.g., Yersinia pestis Xaa-Prolyl Aminopeptidase). In some embodiments, an aminopeptidase from Yersinia pestis is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a naturally-occurring aminopeptidase from Yersinia pestis (e.g., Yersinia pestis Xaa-Prolyl Aminopeptidase).

[0116]In some embodiments, a cleaving reagent comprises an aminopeptidase from Pyrococcus furiosus (e.g., Pyrococcus furiosus Aminopeptidase I). In some embodiments, an aminopeptidase from Pyrococcus furiosus is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a naturally-occurring aminopeptidase from Pyrococcus furiosus (e.g., Pyrococcus furiosus Aminopeptidase I).

[0117]In some embodiments, a cleaving reagent comprises an aminopeptidase from Streptomyces septatus (e.g., Streptomyces septatus TH-2 aminopeptidase). In some embodiments, an aminopeptidase from Streptomyces septatus is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 150.

[0118]In some embodiments, a cleaving reagent comprises an engineered variant of an aminopeptidase from Streptomyces septatus. In some embodiments, the cleaving reagent comprises an amino acid sequence having one or more amino acid substitutions relative to Streptomyces septatus TH-2 aminopeptidase (SEQ ID NO: 150). In some embodiments, the cleaving reagent comprises an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-95%, 85-95%, 90-95%, or 90-98%) identical to SEQ ID NO: 150, where the amino acid sequence comprises an amino acid substitution at one or both positions corresponding to D260 and F283 of SEQ ID NO: 150.

[0119]In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to D260 of SEQ ID NO: 150. In some embodiments, the amino acid substitution is selected from D260F, D260H, D260L, D260M, D260N, D260Q, D260S, and D260V. In some embodiments, the amino acid sequence comprises an amino acid substitution at a position corresponding to F283 of SEQ ID NO: 150. In some embodiments, the amino acid substitution is selected from F283D, F283E, F283M, F283N, and F283 W. In some embodiments, the amino acid sequence comprises amino acid substitutions at positions corresponding to D260 and F283 of SEQ ID NO: 150. In some embodiments, the amino acid substitutions are selected from D260F, D260H, D260L, D260M, D260N, D260Q, D260S, D260V, F283D, F283E, F283M, F283N, and F283 W. In some embodiments, the amino acid sequence is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 151-165.

Tag Sequences

[0120]In some embodiments, a cleaving reagent comprises an aminopeptidase described herein and a tag sequence. As used herein, in some embodiments, a tag sequence refers to a segment of amino acids attached to an aminopeptidase. In some embodiments, a tag sequence is attached to a terminal end (e.g., terminus) of an aminopeptidase. In some embodiments, a tag sequence is attached to the C-terminus of an aminopeptidase (e.g., the C-terminal amino acid of the aminopeptidase). In some embodiments, a tag sequence is attached to the N-terminus of an aminopeptidase (e.g., the N-terminal amino acid of the aminopeptidase). In some embodiments, a tag sequence is attached to an internal position of an aminopeptidase (e.g., an amino acid between the N- and C-terminal amino acids of the aminopeptidase).

[0121]In some embodiments, a tag sequence comprises at least two amino acids. For example, in some embodiments, a tag sequence comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 8, at least 10, at least 15, at least 25, at least 30, at least 40, at least 50, at least 60, at least 80, at least 100, or more, amino acids. In some embodiments, a tag sequence comprises between about 2 and about 200 amino acids (e.g., 2-150 amino acids, 2-100 amino acids, 50-200 amino acids, 50-150 amino acids, 50-100 amino acids, 4-80 amino acids, 5-50 amino acids, 5-30 amino acids, 5-20 amino acids, 10-100 amino acids, 20-80 amino acids, 30-70 amino acids).

[0122]In some embodiments, a tag sequence comprises one or more functional components. In some embodiments, a functional component provides improvements in cleavage activity of the aminopeptidase to which it is attached. For example, in some embodiments, a cleaving reagent comprises a tag sequence that improves one or more properties related to aminopeptidase cleavage activity, such as improvements in one or more of cut depth, rapid sequential cleavage, and cutting efficiency. In some embodiments, a functional component of a tag sequence can provide one or more functions unrelated to aminopeptidase cleavage activity. For example, in some embodiments, a tag sequence comprises one or more of an affinity tag (e.g., a polyhistidine tag), a modification tag (e.g., a biotinylation tag), a solubility tag (e.g., small ubiquitin-like modifier (SUMO) tag), and a linker.

[0123]In some embodiments, a tag sequence comprises a polyhistidine-tag. In some embodiments, a polyhistidine-tag comprises a segment of two or more histidine amino acids. In some embodiments, a polyhistidine-tag comprises a segment of between about 2 and about 15 (e.g., 4, 6, 8, 10, 12, 14, 15) histidine amino acids. In some embodiments, a polyhistidine-tag comprises a hexahistidine-tag (e.g., 6× His-tag (SEQ ID NO: 32)). In some embodiments, a polyhistidine-tag comprises a decahistidine-tag (e.g., 10× His-tag (SEQ ID NO: 34)). In some embodiments, a tag sequence comprises two or more (e.g., two, three, four) polyhistidine-tags.

[0124]In some embodiments, a tag sequence comprises a biotinylation tag. In some embodiments, a biotinylation tag comprises at least one biotin ligase recognition sequence. In some embodiments, a biotinylation tag comprises two biotin ligase recognition sequences oriented in tandem. In some embodiments, a biotin ligase recognition sequence refers to an amino acid sequence that can be recognized by a biotin ligase, which catalyzes a covalent linkage between the sequence and a biotin molecule. In some embodiments, a biotin ligase recognition sequence comprises an amino acid sequence of SEQ ID NO: 36. In some embodiments, a tag sequence comprises two or more (e.g., two, three, four) biotin ligase recognition sequences.

[0125]In some embodiments, a tag sequence comprises at least one polyhistidine-tag and at least one biotin ligase recognition sequence. In some embodiments, a tag sequence comprises at least one polyhistidine-tag and at least two biotin ligase recognition sequences. In some embodiments, a tag sequence comprises at least two polyhistidine-tags and at least one biotin ligase recognition sequence.

[0126]In some embodiments, a tag sequence comprises a solubility tag. In some embodiments, a tag sequence comprises a tag peptide or tag protein. Examples of tag peptides include, without limitation, calmodulin-binding peptide (CBP) tag, FLAG epitope, human influenza hemagglutinin (HA) tag, Myc epitope, streptavidin-binding peptide, Strep tag, Strep-II tag, intrinsically disordered tag, Fasciola hepatica 8-kDa antigen (Fh8), maltose-binding protein (MBP), N-utilization substance (NusA), thioredoxin (Trx), small ubiquitin-like modifier (SUMO), glutathione-S-transferase (GST), solubility-enhancer peptide sequences (SET), IgG domain B1 of Protein G (GB1), IgG repeat domain ZZ of Protein A (ZZ), mutated dehalogenase (HaloTag), Solubility eNhancing Ubiquitous Tag (SNUT), seventeen kilodalton protein (Skp), bacteriophage V5 epitope, phage T7 protein kinase (T7PK), E. coli secreted protein A (EspA), monomeric bacteriophage T7 0.3 protein (Orc protein; Mocr), E. coli trypsin inhibitor (Ecotin), calcium-binding protein (CaBP), stress-responsive arsenate reductase (ArsC), N-terminal fragment of translation initiation factor IF2 (IF2-domain I), stress-responsive proteins (e.g., RpoA, SlyD, Tsf, RpoS, PotD, Crr), and E. coli acidic proteins (e.g., msyB, yjgD, rpoD). Additional examples of tags are known in the art and may be used in accordance with the disclosure. See, e.g., Costa, S., et al. “Fusion tags for protein solubility, purification and immunogenicity in Escherichia coli: the novel Fh8 system.” Front Microbiol. 2014 Feb. 19; 5:63; and Kimple, M. E., et al. “Overview of Affinity Tags for Protein Purification.” Curr Protoc Protein Sci. 2013, 73:Unit 9-9, the relevant contents of which are incorporated by reference herein.

[0127]In some embodiments, a tag sequence comprises a linker. For example, in some embodiments, a tag sequence comprises a polyhistidine-tag and a linker between the polyhistidine-tag and an amino acid of an aminopeptidase. In some embodiments, a tag sequence comprises a biotin ligase recognition sequence and a linker between the biotin ligase recognition sequence and an amino acid of an aminopeptidase. In some embodiments, a tag sequence comprises a biotin ligase recognition sequence, a polyhistidine-tag, and a linker between the biotin ligase recognition sequence and the polyhistidine-tag. In some embodiments, a tag sequence comprises two biotin ligase recognition sequences and a linker between the two biotin ligase recognition sequences.

[0128]In some embodiments, a linker of a tag sequence comprises one or more amino acids. In some embodiments, a linker comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 8, at least 10, at least 12, at least 15, at least 30, at least 25, at least 30, or more, amino acids. In some embodiments, a linker comprises between about 1 and about 50 amino acids (e.g., 1-50 amino acids, 1-30 amino acids, 2-25 amino acids, 3-30 amino acids, 6-25 amino acids, 2-15 amino acids, 1-12 amino acids).

[0129]In some embodiments, a linker of a tag sequence comprises at least one glycine amino acid. In some embodiments, a linker comprises at least one glycine-serine (GS) motif. In some embodiments, a linker comprises an amino acid sequence of the following formula: (GmS)n(SEQ ID NO: 384), where: G is glycine; S is serine; m is an integer from 1 to 5, inclusive; and n is an integer from 1 to 6, inclusive. In some embodiments, m is an integer from 1 to 3, inclusive. In some embodiments, m is 2 or 3. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, n is an integer from 1 to 4, inclusive. In some embodiments, n is an integer from 1 to 3, inclusive. In some embodiments, n is 1 or 3. In some embodiments, n is 1. In some embodiments, n is 3.

[0130]In some embodiments, a cleaving reagent comprises a tag sequence having an amino acid sequence selected from Table 2. In some embodiments, a cleaving reagent comprises a tag sequence having an amino acid sequence that is at least 40% identical to an amino acid sequence selected from Table 2. In some embodiments, a tag sequence has at least 45%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 98%, or higher, amino acid sequence identity to an amino acid sequence selected from Table 2. In some embodiments, a tag sequence has 25-50%, 50-60%, 60-70%, 70-80%, 80-90%, 90-95%, 92-99%, 94-99%, 95-99%, 40-100%, 50-100%, 60-100%, 70-100%, 80-100%, 90-100%, 92-100%, 94-100%, 95-100%, 96-100%, or 100% amino acid sequence identity to an amino acid sequence selected from Table 2.

[0131]Accordingly, in some embodiments, a cleaving reagent comprises an aminopeptidase and a tag sequence, where the aminopeptidase has an amino acid sequence selected from Table 1, and where the tag sequence has an amino acid sequence selected from Table 2. In some embodiments, a cleaving reagent comprises an aminopeptidase and a tag sequence, where the aminopeptidase has an amino acid sequence that is at least 80% identical to an amino acid sequence selected from Table 1, and where the tag sequence has an amino acid sequence that is at least 40% identical to an amino acid sequence selected from Table 2.

[0132]In some aspects, the disclosure provides a single polypeptide comprising an aminopeptidase described herein attached to a tag sequence described herein. For example, in some embodiments, a cleaving reagent comprises a fusion polypeptide of an aminopeptidase fused to a tag sequence. In some embodiments, a fusion polypeptide comprises an aminopeptidase and a tag sequence fused to a terminal end of the aminopeptidase. In some embodiments, a fusion polypeptide comprises an aminopeptidase and a tag sequence fused to the C-terminal end of the aminopeptidase. In some embodiments, a fusion polypeptide comprises an aminopeptidase and a tag sequence fused to the N-terminal end of the aminopeptidase. In some aspects, the disclosure provides a nucleic acid encoding a cleaving reagent described herein. In some embodiments, the nucleic acid is an expression construct encoding a fusion polypeptide of an aminopeptidase fused to a tag sequence.

Compositions, Reaction Mixtures, and Kits

[0133]In some aspects, the disclosure provides compositions comprising at least one cleaving reagent described herein. In some embodiments, a composition comprises two or more cleaving reagents, where at least one cleaving reagent comprises an aminopeptidase and a tag sequence described herein. In some embodiments, a composition comprises two or more cleaving reagents described herein.

[0134]In some aspects, the disclosure provides a composition comprising: a first cleaving reagent comprising a first aminopeptidase from Pyrococcus horikoshii; and a second cleaving reagent comprising a second aminopeptidase from Streptomyces griseus. In some embodiments, the amino acid sequences of the first and second aminopeptidases share less than 80% sequence identity (e.g., less than 70%, less than 60%, less than 50%, 10-80%, 20-60%, 30-50%, or 40-50% sequence identity). In some embodiments, the first cleaving reagent comprises a tag sequence (e.g., first tag sequence) described herein. In some embodiments, the second cleaving reagent comprises a tag sequence (e.g., second tag sequence) described herein. In some embodiments, the composition comprises a third cleaving reagent. In some embodiments, the third cleaving reagent comprises an aminopeptidase from Yersinia pestis.

[0135]In some embodiments, the first and second cleaving reagents are present in the composition at a first and second concentration, respectively, where the first concentration is at least two-fold higher than the second concentration. In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 10:1 and about 500:1 (e.g., between about 50:1 and about 500:1, between about 100:1 and about 500:1, between about 200:1 and about 400:1, between about 250:1 and about 350:1, or between about 275:1 and about 325:1). In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is about 300:1. In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 2:1 and about 20:1 (e.g., between about 2:1 and about 15:1, between about 2:1 and about 10:1, between about 4:1 and about 15:1, or between about 5:1 and about 10:1). In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is about 2:1, about 4:1, about 6:1, about 8:1, or about 10:1.

[0136]In some embodiments, the first cleaving reagent is present at a concentration of between about 10 μM and about 100 μM (e.g., 5-25 μM, 10-15 μM, 10-20 μM, 20-80 μM, 20-60 μM, 20-40 μM, 10-30 μM, 25-35 μM, 30-50 μM, 50-70 μM, 70-90 μM). In some embodiments, the first cleaving reagent is present at a concentration of about 10 μM, about 15 μM, about 20 PM, about 30 μM, about 40 μM, about 60 μM, or about 80 μM. In some embodiments, the first cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes (e.g., 5-50 minutes, 5-30 minutes, 5-20 minutes, 5-15 minutes, 5-10 minutes, 2-30 minutes, 10-30 minutes, 30-60 minutes), where the N-terminal amino acid comprises a charged side chain (e.g., arginine, lysine, glutamine, aspartate, glutamate).

[0137]In some embodiments, the second cleaving reagent is present at a concentration of between about 0.01 μM and about 10 μM (e.g., between about 0.01 μM and about 5 PM, between about 1 μM and about 2 μM, between about 0.01 μM and about 1 μM, or between about 0.05 μM and about 0.5 μM). In some embodiments, the second cleaving reagent is present at a concentration of between about 0.1 μM and about 25 μM (e.g., 0.1-5 μM, 0.5-2.5 PM, 0.1-10 μM, 0.5-20 μM, 1-10 μM, 2-20 μM, 2-15 μM, 1-8 μM). In some embodiments, the second cleaving reagent is present at a concentration of about 0.5 PM, about 1 PM, about 1.5 PM, about 2 μM, about 4 μM, about 6 μM, or about 8 μM. In some embodiments, the second cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes (e.g., 5-50 minutes, 5-30 minutes, 5-20 minutes, 5-15 minutes, 5-10 minutes, 2-30 minutes, 10-30 minutes, 30-60 minutes), where the N-terminal amino acid comprises a hydrophobic side chain (e.g., alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, tryptophan), a polar uncharged side chain (e.g., serine, threonine, cysteine, proline, asparagine, glutamine), or a negatively charged side chain (e.g., aspartate, glutamate).

[0138]In some embodiments, the first aminopeptidase comprises one or more substitutions relative to Pyrococcus horikoshii TET Aminopeptidase III. In some embodiments, the first aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 3. In some embodiments, the first cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 4.

[0139]In some embodiments, the second aminopeptidase comprises one or more substitutions relative to Streptomyces griseus Aminopeptidase. In some embodiments, the second aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 101. In some embodiments, the second cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 102.

[0140]In some embodiments, the second aminopeptidase comprises an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-95%, 85-95%, 90-95%, or 90-98%) identical to SEQ ID NO: 101, where the amino acid sequence comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from M163F, M163I, M163L, M163Y, E198L, E198N, E198Q, E198S, E198T, E198V, E200Q, G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, G201Y, D202N, F221D, F221M, F221N, F221 W, F221Y, A224F, A224I, A224L, and A224V.

[0141]In some embodiments, the amino acid sequence of the second aminopeptidase comprises an amino acid substitution at a position corresponding to G201 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from G201A, G201E, G201F, G201H, G201I, G201L, G201M, G201N, G201V, and G201Y. In some embodiments, the amino acid substitution is G201V.

[0142]In some embodiments, the amino acid sequence of the second aminopeptidase comprises an amino acid substitution at a position corresponding to E198 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from E198L, E198N, E198Q, E198S, E198T, and E198V. In some embodiments, the amino acid substitution is E198V.

[0143]In some embodiments, the amino acid sequence of the second aminopeptidase comprises an amino acid substitution at a position corresponding to F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitution is selected from F221D, F221M, F221N, F221 W, and F221Y. In some embodiments, the amino acid substitution is F221N.

[0144]In some embodiments, the amino acid sequence of the second aminopeptidase comprises amino acid substitutions at positions corresponding to E198, G201, and F221 of SEQ ID NO: 101. In some embodiments, the amino acid substitutions comprise E198V, G201V, and F221N. In some embodiments, the amino acid sequence comprises one or more amino acid substitutions selected from M163F, M163I, M163L, M163Y, E200Q, D202N, A224F, A224I, A224L, and A224V.

[0145]In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 124.

[0146]In some aspects, the disclosure provides a composition comprising a first cleaving reagent comprising a first aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 3; and a second cleaving reagent comprising a second aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 101. In some aspects, the disclosure provides a composition comprising a first cleaving reagent comprising a first aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 3; a second cleaving reagent comprising a second aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 101; and a third cleaving reagent comprising a third aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 5 or 7.

[0147]In some embodiments, at least one of the first, second, and third cleaving reagents comprises a tag sequence described herein. For example, in some embodiments, the first cleaving reagent comprises a first tag sequence; the second cleaving reagent comprises a second tag sequence; and the third cleaving reagent comprises a third tag sequence. In some embodiments, the first tag sequence is attached to a terminal end of the first aminopeptidase; the second tag sequence is attached to a terminal end of the second aminopeptidase; and the third tag sequence is attached to a terminal end of the third aminopeptidase. In some embodiments, each tag sequence is attached to the C-terminus of its respective aminopeptidase.

[0148]In some embodiments, the first, second, and third cleaving reagents are present in the composition at a first, second, and third concentration, respectively, where the first concentration is at least two-fold higher than the second concentration. In some embodiments, the first concentration is at least five-fold higher than the third concentration. In some embodiments, the second concentration is at least two-fold higher than the third concentration.

[0149]In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 10:1 and about 500:1 (e.g., between about 50:1 and about 500:1, between about 100:1 and about 500:1, between about 200:1 and about 400:1, between about 250:1 and about 350:1, or between about 275:1 and about 325:1). In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is about 300:1. In some embodiments, the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 2:1 and about 20:1 (e.g., between about 2:1 and about 15:1, between about 2:1 and about 10:1, between about 4:1 and about 15:1, or between about 5:1 and about 10:1). In some embodiments, the molar ratio of the first cleaving reagent to the third cleaving reagent in the composition is between about 5:1 and about 200:1 (e.g., between about 5:1 and about 150:1, between about 5:1 and about 100:1, between about 10:1 and about 80:1, or between about 10:1 and about 50:1).

[0150]In some embodiments, the first cleaving reagent is present at a concentration of between about 10 μM and about 100 μM (e.g., 5-25 μM, 10-15 μM, 10-20 μM, 20-80 μM, 20-60 μM, 20-40 μM, 10-30 μM, 25-35 μM, 30-50 μM, 50-70 μM, 70-90 μM). In some embodiments, the first cleaving reagent is present at a concentration of about 10 μM, about 15 μM, about 20 PM, about 30 μM, about 40 μM, about 60 μM, or about 80 μM. In some embodiments, the first cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes (e.g., 5-50 minutes, 5-30 minutes, 5-20 minutes, 5-15 minutes, 5-10 minutes, 2-30 minutes, 10-30 minutes, 30-60 minutes), where the N-terminal amino acid comprises a charged side chain (e.g., arginine, lysine, glutamine, aspartate, glutamate).

[0151]In some embodiments, the second cleaving reagent is present at a concentration of between about 0.01 μM and about 10 μM (e.g., between about 0.01 μM and about 5 PM, between about 1 μM and about 2 μM, between about 0.01 μM and about 1 μM, or between about 0.05 μM and about 0.5 μM). In some embodiments, the second cleaving reagent is present at a concentration of between about 0.1 μM and about 25 μM (e.g., 0.1-5 μM, 0.5-2.5 PM, 0.1-10 μM, 0.5-20 μM, 1-10 μM, 2-20 μM, 2-15 μM, 1-8 μM). In some embodiments, the second cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes (e.g., 5-50 minutes, 5-30 minutes, 5-20 minutes, 5-15 minutes, 5-10 minutes, 2-30 minutes, 10-30 minutes, 30-60 minutes), where the N-terminal amino acid comprises a hydrophobic side chain (e.g., alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, tryptophan), a polar uncharged side chain (e.g., serine, threonine, cysteine, proline, asparagine, glutamine), or a negatively charged side chain (e.g., aspartate, glutamate).

[0152]In some embodiments, the third cleaving reagent is present at a concentration of between about 0.01 μM and about 25 μM (e.g., 0.1-10 μM, 0.5-20 μM, 1-10 μM, 2-20 μM, 2-15 μM, 1-8 μM). In some embodiments, the third cleaving reagent is present in an amount sufficient to cleave an N-terminal amino acid from a polypeptide with an average cleavage time of between about 2 and about 60 minutes (e.g., 5-50 minutes, 5-30 minutes, 5-20 minutes, 5-15 minutes, 5-10 minutes, 2-30 minutes, 10-30 minutes, 30-60 minutes), where the polypeptide comprises an XP dipeptide motif, where: X is the N-terminal amino acid, and P is a proline amino acid.

[0153]In some embodiments, the amino acid sequence of the first aminopeptidase is at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 3. In some embodiments, the first cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 4.

[0154]In some embodiments, the amino acid sequence of the second aminopeptidase is at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 101. In some embodiments, the amino acid sequence of the second aminopeptidase comprises one or more amino acid substitutions relative to SEQ ID NO: 101, as described herein (e.g., an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101). In some embodiments, the second cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 102. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 124.

[0155]In some embodiments, the amino acid sequence of the third aminopeptidase is at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 5 or 7. In some embodiments, the third cleaving reagent is a polypeptide having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 8.

[0156]In some aspects, the disclosure provides a reaction mixture for polypeptide analysis, the reaction mixture comprising: a composition described herein; and one or more amino acid recognizers (e.g., one or more amino acid binding proteins not having peptide cleavage activity). In some embodiments, an amino acid recognizer comprises an amino acid binding protein, such as a ClpS protein (e.g., Planctomycetia bacterium ClpS protein), a UBR protein (e.g., Kluyveromyces marxianus UBR protein), an Ntaq1 protein (e.g., Scleropages formosus Ntaq1 protein), or a variant or homolog thereof. In some embodiments, an amino acid recognizer comprises a label (e.g., a detectable label, such as a luminescent label). Examples of amino acid recognizers (e.g., recognition molecules) are described in detail in PCT International Publication No. WO2020/102741A1, filed Nov. 15, 2019, PCT International Publication No. WO2021/236983A2, filed May 20, 2021, and PCT International Publication No. WO2024/031031A2, filed Aug. 3, 2023, the relevant content of each of which is incorporated by reference in its entirety.

[0157]In some aspects, the disclosure provides a reaction mixture for polypeptide analysis, the reaction mixture comprising: a cleaving reagent comprising an aminopeptidase having an amino acid sequence that is at least 80% identical to a sequence selected from any one of SEQ ID NOs: 101-143; and one or more amino acid binding proteins not having peptide cleavage activity. In some embodiments, the amino acid sequence of the aminopeptidase is at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 101-143. In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 101. In some embodiments, the amino acid sequence of the aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 102. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 109. In some embodiments, the amino acid sequence of the second aminopeptidase is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to SEQ ID NO: 124. In some embodiments, the reaction mixture further comprises one or more cleaving reagents described herein.

[0158]In some aspects, the disclosure provides a reaction mixture for polypeptide analysis, the reaction mixture comprising: a first aminopeptidase having an amino acid sequence that is at least 92% identical to SEQ ID NO: 3 and comprising a first tag sequence; and one or more amino acid binding proteins not having peptide cleavage activity. In some embodiments, the amino acid sequence of the first aminopeptidase is at least 94%, at least 96%, at least 98%, or 100% identical to SEQ ID NO: 3. In some embodiments, the reaction mixture further comprises one or more cleaving reagents described herein.

[0159]As described herein, compositions and reaction mixtures of the disclosure can be used to determine at least one chemical characteristic of a polypeptide based on a characteristic pattern. In some embodiments, polypeptide sequencing reaction conditions can be configured to achieve a time interval that allows for sufficient association events which provide a desired confidence level with a characteristic pattern. This can be achieved, for example, by configuring the reaction conditions based on various properties, including: reagent concentration, molar ratio of one reagent to another (e.g., ratio of amino acid recognizer to cleaving reagent, ratio of one recognizer to another, ratio of one cleaving reagent to another), number of different reagent types (e.g., the number of different types of recognizers and/or cleaving reagents, the number of recognizer types relative to the number of cleaving reagent types), cleavage activity (e.g., aminopeptidase activity), binding properties (e.g., kinetic and/or thermodynamic binding parameters for recognition molecule binding), reagent modification (e.g., polyol and other recognizer modifications which can alter interaction dynamics), reaction mixture components (e.g., one or more components, such as pH, buffering agent, salt, divalent cation, surfactant, and other reaction mixture components described herein), temperature of the reaction, and various other parameters apparent to those skilled in the art, and combinations thereof. The reaction conditions can be configured based on one or more aspects described herein, including, for example, signal pulse information (e.g., pulse duration, interpulse duration, change in magnitude), labeling strategies (e.g., number and/or type of fluorophore, linkers with or without shielding element), surface modification (e.g., modification of sample well surface, including polypeptide immobilization), sample preparation (e.g., polypeptide fragment size, polypeptide modification for immobilization), and other aspects described herein.

[0160]In some embodiments, a polypeptide sequencing reaction in accordance with the disclosure is performed under conditions in which recognition and cleavage of amino acids can occur simultaneously in a single reaction mixture. For example, in some embodiments, a polypeptide sequencing reaction is performed in a reaction mixture having a pH at which association events and cleavage events can occur. Accordingly, in some embodiments, a reaction mixture has a pH of between about 6.5 and about 9.0. In some embodiments, a reaction mixture has a pH of between about 7.0 and about 8.5 (e.g., between about 7.0 and about 8.0, between about 7.5 and about 8.5, between about 7.5 and about 8.0, or between about 8.0 and about 8.5).

[0161]In some embodiments, a polypeptide sequencing reaction is performed in a reaction mixture comprising one or more buffering agents. In some embodiments, a reaction mixture comprises a buffering agent in a concentration of at least 10 mM (e.g., at least 20 mM and up to 250 mM, at least 50 mM, 10-250 mM, 10-100 mM, 20-100 mM, 50-100 mM, or 100-200 mM). In some embodiments, a reaction mixture comprises a buffering agent in a concentration of between about 10 mM and about 50 mM (e.g., between about 10 mM and about 25 mM, between about 25 mM and about 50 mM, or between about 20 mM and about 40 mM). Examples of buffering agents include, without limitation, HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid), Tris (tris(hydroxymethyl)aminomethane), and MOPS (3-(N-morpholino)propanesulfonic acid).

[0162]In some embodiments, a polypeptide sequencing reaction is performed in a reaction mixture comprising salt in a concentration of at least 10 mM. In some embodiments, a reaction mixture comprises salt in a concentration of at least 10 mM (e.g., at least 20 mM, at least 50 mM, at least 100 mM, or more). In some embodiments, a reaction mixture comprises salt in a concentration of between about 10 mM and about 250 mM (e.g., between about 20 mM and about 200 mM, between about 50 mM and about 150 mM, between about 10 mM and about 50 mM, or between about 10 mM and about 100 mM). Examples of salts include, without limitation, sodium salts, potassium salts, and acetates, such as sodium chloride (NaCl), sodium acetate (NaOAc), and potassium acetate (KOAc).

[0163]Additional examples of components for use in a reaction mixture include divalent cations (e.g., Mg2+, Co2+) and surfactants (e.g., polysorbate 20). In some embodiments, a reaction mixture comprises a divalent cation in a concentration of between about 0.1 mM and about 50 mM (e.g., between about 10 mM and about 50 mM, between about 0.1 mM and about 10 mM, or between about 1 mM and about 20 mM). In some embodiments, a reaction mixture comprises a surfactant in a concentration of at least 0.01% (e.g., between about 0.01% and about 0.10%). In some embodiments, a reaction mixture comprises one or more components useful in single-molecule analysis, such as an oxygen-scavenging system (e.g., a PCA/PCD system or a Pyranose oxidase/Catalase/glucose system) and/or one or more triplet state quenchers (e.g., trolox, COT, and NBA).

[0164]In some embodiments, a polypeptide sequencing reaction is performed at a temperature at which association events and cleavage events can occur. In some embodiments, a polypeptide sequencing reaction is performed at a temperature of at least 10° C. In some embodiments, a polypeptide sequencing reaction is performed at a temperature of between about 10° C. and about 50° C. (e.g., 15-45° C., 20-40° C., at or around 25° C., at or around 30° C., at or around 35° C., at or around 37° C.). In some embodiments, a polypeptide sequencing reaction is performed at or around room temperature.

[0165]As detailed above, a real-time sequencing process as illustrated by FIG. 1A can generally involve cycles of amino acid recognition and terminal amino acid cleavage. In some embodiments, the relative occurrence of recognition and cleavage can be controlled by a concentration differential between one or more amino acid recognizers and at least one cleaving reagent. In some embodiments, the concentration differential can be optimized such that the number of signal pulses detected during recognition of an individual amino acid provides a desired confidence interval for identification. For example, if an initial sequencing reaction provides signal data with too few signal pulses between cleavage events to permit determination of characteristic patterns with a desired confidence interval, the sequencing reaction can be repeated using a decreased concentration of non-specific exopeptidase relative to recognition molecule.

[0166]In some embodiments, polypeptide analysis in accordance with the disclosure may be carried out by contacting a polypeptide with a reaction mixture comprising one or more amino acid recognizers and one or more cleaving reagents (e.g., peptidases). In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of between about 10 nM and about 10 M. In some embodiments, a reaction mixture comprises a cleaving reagent at a concentration of between about 500 nM and about 500 M.

[0167]In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of between about 100 nM and about 10 M, between about 250 nM and about 10 M, between about 100 nM and about 1 M, between about 250 nM and about 1 M, between about 250 nM and about 750 nM, or between about 500 nM and about 1 M. In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of about 100 nM, about 250 nM, about 500 nM, about 750 nM, or about 1 M. In some embodiments, a reaction mixture comprises a cleaving reagent at a concentration of between about 500 nM and about 250 M, between about 500 nM and about 100 M, between about 1 M and about 100 M, between about 500 nM and about 50 M, between about 1 M and about 100 M, between about 10 M and about 200 M, or between about 10 M and about 100 M. In some embodiments, a reaction mixture comprises a cleaving reagent at a concentration of about 1 M, about 5 M, about 10 M, about 30 M, about 50 M, about 70 M, or about 100 M.

[0168]In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of between about 10 nM and about 10 M, and a cleaving reagent at a concentration of between about 500 nM and about 500 M. In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of between about 100 nM and about 1 M, and a cleaving reagent at a concentration of between about 1 M and about 100 μM In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of between about 250 nM and about 1 M, and a cleaving reagent at a concentration of between about 10 M and about 100 M. In some embodiments, a reaction mixture comprises an amino acid recognizer at a concentration of about 500 nM, and a cleaving reagent at a concentration of between about 25 M and about 75 M. In some embodiments, the concentration of an amino acid recognizer and/or the concentration of a cleaving reagent in a reaction mixture is as described elsewhere herein.

[0169]In some embodiments, a reaction mixture comprises an amino acid recognizer and a cleaving reagent in a molar ratio of about 500:1, about 400:1, about 300:1, about 200:1, about 100:1, about 75:1, about 50:1, about 25:1, about 10:1, about 5:1, about 2:1, or about 1:1. In some embodiments, a reaction mixture comprises an amino acid recognizer and a cleaving reagent in a molar ratio of between about 10:1 and about 200:1. In some embodiments, a reaction mixture comprises an amino acid recognizer and a cleaving reagent in a molar ratio of between about 50:1 and about 150:1. In some embodiments, the molar ratio of an amino acid recognizer to a cleaving reagent in a reaction mixture is between about 1:1,000 and about 1:1 or between about 1:1 and about 100:1 (e.g., 1:1,000, about 1:500, about 1:200, about 1:100, about 1:10, about 1:5, about 1:2, about 1:1, about 5:1, about 10:1, about 50:1, about 100:1). In some embodiments, the molar ratio of an amino acid recognizer to a cleaving reagent in a reaction mixture is between about 1:100 and about 1:1 or between about 1:1 and about 10:1. In some embodiments, the molar ratio of an amino acid recognizer to a cleaving reagent in a reaction mixture is as described elsewhere herein.

[0170]In some embodiments, a reaction mixture comprises one or more amino acid recognizers and one or more cleaving reagents described herein. In some embodiments, a reaction mixture comprises at least three amino acid recognizers and at least one cleaving reagent. In some embodiments, the reaction mixture comprises two or more cleaving reagents. In some embodiments, the reaction mixture comprises at least one and up to ten cleaving reagents (e.g., 1-3 cleaving reagents, 2-10 cleaving reagents, 1-5 cleaving reagents, 3-10 cleaving reagents). In some embodiments, the reaction mixture comprises at least three and up to thirty amino acid recognizers (e.g., between 3 and 25, between 3 and 20, between 3 and 10, between 3 and 5, between 5 and 30, between 5 and 20, between 5 and 10, or between 10 and 20, amino acid recognizers).

[0171]In some embodiments, a reaction mixture comprises more than one amino acid recognizer and/or more than one cleaving reagent. In some embodiments, a reaction mixture described as comprising more than one amino acid recognizer or cleaving reagent refers to the mixture as having more than one type of amino acid recognizer or cleaving reagent. For example, in some embodiments, a reaction mixture comprises two or more cleaving reagents, where the two or more cleaving reagents refer to two or more types of aminopeptidases. In some embodiments, one type of aminopeptidase has an amino acid sequence that is different from another type of aminopeptidase in the reaction mixture. In some embodiments, one type of cleaving reagent cleaves an amino acid or subset of amino acids that is different from an amino acid or subset of amino acids cleaved by another type of cleaving reagent in the reaction mixture.

[0172]In some aspects, the disclosure provides a kit comprising one or more cleaving reagents (e.g., aminopeptidases) described herein. In some embodiments, a kit comprises one or more cleaving reagents comprising an aminopeptidase having an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from Table 1. In some embodiments, a kit comprises between about 1 and about 20 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1-15, 1-10, 2-10, 3-10, 5-10, 2-4, or 2-5) cleaving reagents, each cleaving reagent comprising an aminopeptidase having an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to a sequence selected from Table 1.

[0173]In some embodiments, a kit comprises at least one cleaving reagent comprising an aminopeptidase from Streptomyces griseus or a homolog or variant thereof. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 101 or 102. In some embodiments, the amino acid sequence of the second aminopeptidase comprises one or more amino acid substitutions relative to SEQ ID NO: 101, as described herein (e.g., an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO: 101). In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 103-143. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 109. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 124.

[0174]In some embodiments, a kit comprises at least one cleaving reagent comprising an aminopeptidase from Streptomyces septatus (e.g., Streptomyces septatus TH-2 aminopeptidase) or a homolog or variant thereof. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 150. In some embodiments, the amino acid sequence of the second aminopeptidase comprises one or more amino acid substitutions relative to SEQ ID NO: 150, as described herein (e.g., an amino acid substitution at one or both positions corresponding to D260 and F283 of SEQ ID NO: 150). In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 151-165.

[0175]In some embodiments, a kit comprises at least one cleaving reagent comprising an aminopeptidase from Pyrococcus horikoshii or a homolog or variant thereof. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 1-4. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 3. In some embodiments, the aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 4.

[0176]In some embodiments, a kit comprises at least one cleaving reagent comprising an X-P aminopeptidase or a homolog or variant thereof. In some embodiments, the X-P aminopeptidase has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 5-8 and 144. In some embodiments, the X-P aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 5 or 7. In some embodiments, the X-P aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 8. In some embodiments, the X-P aminopeptidase has an amino acid sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100%) identical to SEQ ID NO: 144.

[0177]In some embodiments, a kit comprises at least one cleaving reagent comprising an aminopeptidase having an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, 80-100%, 85-95%, 90-99%, 95-99%, or 100% identical to a sequence selected from any one of SEQ ID NOs: 9-31.

[0178]In some embodiments, a kit further comprises one or more amino acid recognizers (e.g., one or more amino acid binding proteins not having peptide cleavage activity). In some embodiments, an amino acid recognizer comprises an amino acid binding protein, such as a ClpS protein (e.g., Planctomycetia bacterium ClpS protein), a UBR protein (e.g., Kluyveromyces marxianus UBR protein), an Ntaq1 protein (e.g., Scleropages formosus Ntaq1 protein), or a variant or homolog thereof. In some embodiments, an amino acid recognizer comprises a label (e.g., a detectable label, such as a luminescent label). Examples of amino acid recognizers (e.g., recognition molecules) are described in detail in PCT International Publication No. WO2020/102741A1, filed Nov. 15, 2019, PCT International Publication No. WO2021/236983A2, filed May 20, 2021, and PCT International Publication No. WO2024/031031A2, filed Aug. 3, 2023, the relevant content of each of which is incorporated by reference in its entirety.

[0179]In some embodiments, a kit further comprises instructions for using the kit in a method of polypeptide analysis (e.g., according to a method described herein).

Polypeptide Analysis

[0180]In some aspects, the disclosure provides methods of polypeptide analysis (e.g., polypeptide sequencing). In some embodiments, a method of polypeptide analysis comprises: contacting a polypeptide with a reaction mixture described herein; monitoring a signal for signal pulses corresponding to interactions between one or more amino acid binding proteins and the polypeptide; and determining at least one chemical characteristic of the polypeptide based on a characteristic pattern in the signal.

[0181]A non-limiting example of polypeptide structure analysis by detecting single molecule binding interactions during a polypeptide degradation process is illustrated in FIG. 1A. An example signal trace is shown depicting different association (e.g., binding) events at times corresponding to changes in the signal. As shown, an association event between an amino acid recognizer and a terminal end of a polypeptide produces a change in magnitude of the signal that persists for a duration of time. Different association events are illustrated for different amino acids exposed at the terminal end of the polypeptide. As described herein, an amino acid that is “exposed” at the terminus of a polypeptide is an amino acid that is still attached to the polypeptide and that becomes the terminal amino acid upon removal of the prior terminal amino acid during degradation (e.g., either alone or along with one or more additional amino acids).

[0182]As generically depicted, the association events between amino acid recognizers and different types of amino acids at the terminal end of the polypeptide produce distinctive changes in the signal, referred to herein as a characteristic pattern, which may be used to determine chemical characteristics of the polypeptide. In some embodiments, a characteristic pattern corresponding to one type of terminal amino acid can be used to determine structural information for the terminal amino acid and one or more amino acids contiguous to the terminal amino acid. Accordingly, in some embodiments, a characteristic pattern corresponding to one type of terminal amino acid can be used to determine structural information for at least two (e.g., at least three, at least four, at least five, two, three, four, or between two and five) amino acids of a polypeptide.

[0183]In some embodiments, a transition from one characteristic pattern to another is indicative of amino acid cleavage. As used herein, in some embodiments, amino acid cleavage refers to the removal of at least one amino acid from a terminus of a polypeptide (e.g., the removal of at least one terminal amino acid from the polypeptide). In some embodiments, amino acid cleavage is determined by inference based on a time duration between characteristic patterns. In some embodiments, amino acid cleavage is determined by detecting a change in signal produced by association of a labeled cleaving reagent with an amino acid at the terminus of the polypeptide. As amino acids are sequentially cleaved from the terminus of the polypeptide during degradation, a series of changes in magnitude, or a series of signal pulses, is detected.

[0184]In some embodiments, signal data can be analyzed to extract signal pulse information by applying threshold levels to one or more parameters of the signal data. For example, in some embodiments, a threshold magnitude level may be applied to the signal data of a signal trace. In some embodiments, the threshold magnitude level is a minimum difference between a signal detected at a point in time and a baseline determined for a given set of data. In some embodiments, a signal pulse is assigned to each portion of the data that is indicative of a change in magnitude exceeding the threshold magnitude level and persisting for a duration of time. In some embodiments, a threshold time duration may be applied to a portion of the data that satisfies the threshold magnitude level to determine whether a signal pulse is assigned to that portion. For example, experimental artifacts may give rise to a change in magnitude exceeding the threshold magnitude level but that does not persist for a duration of time sufficient to assign a signal pulse with a desired confidence (e.g., transient association events which could be non-discriminatory for amino acid type, non-specific detection events such as diffusion into an observation region or reagent sticking within an observation region). Accordingly, in some embodiments, a signal pulse is extracted from signal data based on a threshold magnitude level and a threshold time duration.

[0185]In some embodiments, a peak in magnitude of a signal pulse is determined by averaging the magnitude detected over a duration of time that persists above the threshold magnitude level. It should be appreciated that, in some embodiments, a “signal pulse” as used herein can refer to a change in signal data that persists for a duration of time above a baseline (e.g., raw signal data), or to signal pulse information extracted therefrom (e.g., processed signal data).

[0186]In some embodiments, signal pulse information can be analyzed to identify different types of amino acids in a polypeptide based on different characteristic patterns in a series of signal pulses. For example, as shown in FIG. 1A, the signal pulse information is indicative of different types of amino acids at a terminal end of a polypeptide (e.g., arginine, leucine, isoleucine, phenylalanine). By way of example, the signal pulses detected at the earliest time points provide information indicative of (at least) arginine at the terminus of the polypeptide based on a first characteristic pattern, and the signal pulses detected at the latest time points provide information indicative of at least phenylalanine at the terminus of the polypeptide based on a second characteristic pattern.

[0187]In some embodiments, each signal pulse of a characteristic pattern comprises a pulse duration corresponding to an association event between an amino acid recognizer and an amino acid ligand. In some embodiments, the pulse duration is characteristic of a dissociation rate of binding. In some embodiments, each signal pulse of a characteristic pattern is separated from another signal pulse of the characteristic pattern by an interpulse duration. In some embodiments, the interpulse duration is characteristic of an association rate of binding. In some embodiments, a change in magnitude in a signal can be determined for a signal pulse based on a difference between baseline and the peak of a signal pulse. In some embodiments, a characteristic pattern is determined based on pulse duration. In some embodiments, a characteristic pattern is determined based on pulse duration and interpulse duration. In some embodiments, a characteristic pattern is determined based on any one or more of pulse duration, interpulse duration, and change in magnitude.

[0188]Accordingly, as illustrated by FIG. 1A, in some embodiments, polypeptide analysis is performed by detecting a series of signal pulses indicative of association of one or more amino acid recognizers with successive amino acids exposed at the terminus of a polypeptide in an ongoing degradation reaction. The series of signal pulses can be analyzed to determine characteristic patterns in the series of signal pulses, and the time course of characteristic patterns can be used to determine chemical characteristics throughout an amino acid sequence of the polypeptide.

[0189]As described herein, signal pulse information may be used to identify an amino acid based on a characteristic pattern in a series of signal pulses. In some embodiments, a characteristic pattern comprises a plurality of signal pulses, each signal pulse comprising a pulse duration. In some embodiments, the plurality of signal pulses may be characterized by a summary statistic (e.g., mean, median, time decay constant) of the distribution of pulse durations in a characteristic pattern. In some embodiments, the mean pulse duration of a characteristic pattern is between about 1 millisecond and about 10 seconds (e.g., between about 1 ms and about 1 s, between about 1 ms and about 100 ms, between about 1 ms and about 10 ms, between about 10 ms and about 10 s, between about 100 ms and about 10 s, between about 1 s and about 10 s, between about 10 ms and about 100 ms, or between about 100 ms and about 500 ms). In some embodiments, the mean pulse duration is between about 50 milliseconds and about 2 seconds, between about 50 milliseconds and about 500 milliseconds, or between about 500 milliseconds and about 2 seconds.

[0190]In some embodiments, different characteristic patterns corresponding to different types of amino acids in a single polypeptide may be distinguished from one another based on a statistically significant difference in the summary statistic. For example, in some embodiments, one characteristic pattern may be distinguishable from another characteristic pattern based on a difference in mean pulse duration of at least 10 milliseconds (e.g., between about 10 ms and about 10 s, between about 10 ms and about 1 s, between about 10 ms and about 100 ms, between about 100 ms and about 10 s, between about 1 s and about 10 s, or between about 100 ms and about 1 s). In some embodiments, the difference in mean pulse duration is at least 50 ms, at least 100 ms, at least 250 ms, at least 500 ms, or more. In some embodiments, the difference in mean pulse duration is between about 50 ms and about 1 s, between about 50 ms and about 500 ms, between about 50 ms and about 250 ms, between about 100 ms and about 500 ms, between about 250 ms and about 500 ms, or between about 500 ms and about 1 s. In some embodiments, the mean pulse duration of one characteristic pattern is different from the mean pulse duration of another characteristic pattern by about 10-25%, 25-50%, 50-75%, 75-100%, or more than 100%, for example by about 2-fold, 3-fold, 4-fold, 5-fold, or more. It should be appreciated that, in some embodiments, smaller differences in mean pulse duration between different characteristic patterns may require a greater number of pulse durations within each characteristic pattern to distinguish one from another with statistical confidence.

[0191]In some embodiments, a characteristic pattern generally refers to a plurality of association events between an amino acid of a polypeptide and a means for binding the amino acid (e.g., an amino acid recognition molecule). In some embodiments, a characteristic pattern comprises at least 10 association events (e.g., at least 25, at least 50, at least 75, at least 100, at least 250, at least 500, at least 1,000, or more, association events). In some embodiments, a characteristic pattern comprises between about 10 and about 1,000 association events (e.g., between about 10 and about 500 association events, between about 10 and about 250 association events, between about 10 and about 100 association events, or between about 50 and about 500 association events). In some embodiments, the plurality of association events is detected as a plurality of signal pulses.

[0192]In some embodiments, a characteristic pattern refers to a plurality of signal pulses which may be characterized by a summary statistic as described herein. In some embodiments, a characteristic pattern comprises at least 10 signal pulses (e.g., at least 25, at least 50, at least 75, at least 100, at least 250, at least 500, at least 1,000, or more, signal pulses). In some embodiments, a characteristic pattern comprises between about 10 and about 1,000 signal pulses (e.g., between about 10 and about 500 signal pulses, between about 10 and about 250 signal pulses, between about 10 and about 100 signal pulses, or between about 50 and about 500 signal pulses).

[0193]In some embodiments, a characteristic pattern refers to a plurality of association events between an amino acid recognition molecule and an amino acid of a polypeptide occurring over a time interval prior to removal of the amino acid (e.g., a cleavage event). In some embodiments, a characteristic pattern refers to a plurality of association events occurring over a time interval between two cleavage events (e.g., prior to removal of the amino acid and after removal of an amino acid previously exposed at the terminus). In some embodiments, the time interval of a characteristic pattern is between about 1 minute and about 30 minutes (e.g., between about 1 minute and about 20 minutes, between about 1 minute and 10 minutes, between about 5 minutes and about 20 minutes, between about 5 minutes and about 15 minutes, or between about 5 minutes and about 10 minutes).

[0194]In some embodiments, the series of signal pulses comprises a series of changes in magnitude of an optical signal over time. In some embodiments, the series of changes in the optical signal comprises a series of changes in luminescence produced during association events. In some embodiments, luminescence is produced by a detectable label associated with one or more reagents of a sequencing reaction. For example, in some embodiments, each of the one or more amino acid recognizers comprises a luminescent label. In some embodiments, a cleaving reagent comprises a luminescent label. Examples of luminescent labels and their use in accordance with the disclosure are provided herein.

[0195]In some embodiments, the series of signal pulses comprises a series of changes in magnitude of an electrical signal over time. In some embodiments, the series of changes in the electrical signal comprises a series of changes in conductance produced during association events. In some embodiments, conductivity is produced by a detectable label associated with one or more reagents of a sequencing reaction. For example, in some embodiments, each of the one or more amino acid recognizers comprises a conductivity label. Examples of conductivity labels and their use in accordance with the disclosure are provided elsewhere herein. Methods for identifying single molecules using conductivity labels have been described (see, e.g., U.S. Patent Publication No. 2017/0037462).

[0196]In some embodiments, the series of changes in conductance comprises a series of changes in conductance through a nanopore. For example, methods of evaluating receptor-ligand interactions using nanopores have been described (see, e.g., Thakur, A. K. & Movileanu, L. (2019) Nature Biotechnology 37(1)). The inventors have recognized and appreciated that such nanopores may be used to monitor polypeptide sequencing reactions in accordance with the disclosure. Accordingly, in some embodiments, the disclosure provides methods of polypeptide analysis comprising contacting a single polypeptide molecule with one or more amino acid recognizers described herein, where the single polypeptide molecule is immobilized to a nanopore. In some embodiments, the methods further comprise detecting a series of changes in conductance through the nanopore indicative of association of the one or more amino acid recognizers with successive amino acids exposed at a terminus of the single polypeptide while the single polypeptide is being degraded.

[0197]As described herein, in some embodiments, amino acid recognizers of the disclosure may be used to determine at least one chemical characteristic of a polypeptide. In some embodiments, determining at least one chemical characteristic comprises determining the type of amino acid that is present at a terminal end of a polypeptide and/or the types of amino acids that are present at one or more positions contiguous to the amino acid at the terminal end. In some embodiments, determining the type of amino acid comprises determining the actual amino acid identity, for example by determining which of the naturally-occurring 20 amino acids is present. In some embodiments, the type of amino acid is selected from alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, selenocysteine, serine, threonine, tryptophan, tyrosine, and valine.

[0198]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining a subset of potential amino acids that can be present in the polypeptide. In some embodiments, this can be accomplished by determining that an amino acid is not one or more specific amino acids (and therefore could be any of the other amino acids). In some embodiments, this can be accomplished by determining which of a specified subset of amino acids (e.g., based on size, charge, hydrophobicity, post-translational modification, binding properties) could be in the polypeptide (e.g., using a recognizer that binds to a specified subset of two or more amino acids).

[0199]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises a post-translational modification. Non-limiting examples of post-translational modifications include acetylation (e.g., acetylated lysine), ADP-ribosylation, caspase cleavage, citrullination, formylation, N-linked glycosylation (e.g., glycosylated asparagine), O-linked glycosylation (e.g., glycosylated serine, glycosylated threonine), hydroxylation, methylation (e.g., methylated lysine, methylated arginine), myristoylation (e.g., myristoylated glycine), neddylation, nitration (e.g., nitrated tyrosine), chlorination (e.g., chlorinated tyrosine), oxidation/reduction (e.g., oxidized cysteine, oxidized methionine), palmitoylation (e.g., palmitoylated cysteine), phosphorylation, prenylation (e.g., prenylated cysteine), S-nitrosylation (e.g., S-nitrosylated cysteine, S-nitrosylated methionine), sulfation, sumoylation (e.g., sumoylated lysine), and ubiquitination (e.g., ubiquitinated lysine).

[0200]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises an arginine post-translational modification. For example, as described herein, amino acid recognizers of the disclosure are capable of distinguishing between different arginine modifications, including symmetric dimethylarginine (SDMA), asymmetric dimethylarginine (ADMA), and citrullinated arginine.

[0201]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises a phosphorylated side chain. For example, in some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises phosphorylated threonine (e.g., phospho-threonine). In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises phosphorylated tyrosine (e.g., phospho-tyrosine). In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises phosphorylated serine (e.g., phospho-serine).

[0202]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises a chemically modified variant, an unnatural amino acid, or a proteinogenic amino acid such as selenocysteine and pyrrolysine. Examples of unnatural amino acids include, without limitation, 2-naphthyl-alanine, statine, homoalanine, α-amino acid, β2-amino acid, β3-amino acid, 7-amino acid, 3-pyridyl-alanine, 4-fluorophenyl-alanine, cyclohexyl-alanine, N-alkyl amino acid, peptoid amino acid, homo-cysteine, penicillamine, 3-nitro-tyrosine, homo-phenyl-alanine, t-leucine, hydroxy-proline, 3-Abz, 5-F-tryptophan, and azabicyclo-[2.2.1]heptane.

[0203]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises an oxidative modification. For example, as described herein, amino acid recognizers of the disclosure are capable of distinguishing between oxidized methionine and its unmodified variant. In some embodiments, the oxidative modification comprises an oxidatively-damaged side chain of an amino acid. In some embodiments, the oxidatively-damaged side chain comprises a cysteine-derived product (e.g., disulfide, sulfinic acid, sulfonic acid, sulfenic acid, S-nitrosocysteine), a tyrosine-derived product (e.g., di-tyrosine, 3,4-dihydroxyphenylalanine, 3-chlorotyrosine, 3-nitrotyrosine), a histidine-derived product (e.g., 2-oxohistidine, 4-hydroxy-2-oxohistidine, di-histidine, asparagine, aspartic acid, urea), a methionine-derived product (e.g., sulfoxide, sulfone), a tryptophan-derived product (e.g., di-tryptophan, N-formylkynurenine, kynurenine, 2-oxo-tryptophan oxindolylalanine, 6-nitrotryptophan, hydroxytryptophan), a phenylalanine-derived product (e.g., meta-tyrosine, ortho-tyrosine), or a generic side-chain product (e.g., alcohol, hydroperoxide, aldehyde/ketone carbonyl). Examples of oxidatively damaged amino acids are known in the art, see, e.g., Hawkins, C. L., Davies, M. J. Detection, identification, and quantification of oxidative protein modifications. J Biol Chem. 2019 Dec. 20; 294(51):19683-19708.

[0204]In some embodiments, determining at least one chemical characteristic of a polypeptide comprises determining that an amino acid comprises a side chain characterized by one or more biochemical properties. For example, an amino acid may comprise a nonpolar aliphatic side chain, a positively charged side chain, a negatively charged side chain, a nonpolar aromatic side chain, or a polar uncharged side chain. Non-limiting examples of an amino acid comprising a nonpolar aliphatic side chain include alanine, glycine, valine, leucine, methionine, and isoleucine. Non-limiting examples of an amino acid comprising a positively charged side chain includes lysine, arginine, and histidine. Non-limiting examples of an amino acid comprising a negatively charged side chain include aspartate and glutamate. Non-limiting examples of an amino acid comprising a nonpolar, aromatic side chain include phenylalanine, tyrosine, and tryptophan. Non-limiting examples of an amino acid comprising a polar uncharged side chain include serine, threonine, cysteine, proline, asparagine, and glutamine.

[0205]In some embodiments, a protein or polypeptide can be digested into a plurality of smaller polypeptides and chemical characteristics can be determined for one or more of these smaller polypeptides. In some embodiments, a first terminus (e.g., N or C terminus) of a polypeptide is immobilized and the other terminus (e.g., the C or N terminus) is analyzed as described herein.

[0206]As used herein, sequencing a polypeptide refers to determining sequence information for a polypeptide. In some embodiments, this can involve determining the identity of each sequential amino acid for a portion (or all) of the polypeptide. However, in some embodiments, this can involve assessing the identity of a subset of amino acids within the polypeptide (e.g., and determining the relative position of one or more amino acid types without determining the identity of each amino acid in the polypeptide). However, in some embodiments, amino acid content information can be obtained from a polypeptide without directly determining the relative position of different types of amino acids in the polypeptide. The amino acid content alone may be used to infer the identity of the polypeptide that is present (e.g., by comparing the amino acid content to a database of polypeptide information and determining which polypeptide(s) have the same amino acid content).

[0207]In some embodiments, sequence information for a plurality of polypeptide products obtained from a longer polypeptide or protein (e.g., via enzymatic and/or chemical cleavage) can be analyzed to reconstruct or infer the sequence of the longer polypeptide or protein.

[0208]In some aspects, the polypeptide analysis described herein generates data indicating how a polypeptide interacts with a binding means while the polypeptide is being degraded by a cleaving means. As discussed above, the data can include a series of characteristic patterns corresponding to association events at a terminus of a polypeptide in between cleavage events at the terminus. In some embodiments, methods of polypeptide analysis described herein comprise contacting a single polypeptide molecule with a binding means and a cleaving means, where the binding means and the cleaving means are configured to achieve at least 10 association events prior to a cleavage event. In some embodiments, the means are configured to achieve the at least 10 association events between two cleavage events.

[0209]In some embodiments, a plurality of single-molecule sequencing reactions are performed in parallel in an array of sample wells. In some embodiments, an array comprises between about 10,000 and about 1,000,000 sample wells. The volume of a sample well may be between about 10−21 liters and about 10−15 liters, in some implementations. Because the sample well has a small volume, detection of single-molecule events may be possible as only about one polypeptide may be within a sample well at any given time. Statistically, some sample wells may not contain a single-molecule sequencing reaction and some may contain more than one single polypeptide molecule. However, an appreciable number of sample wells may each contain a single-molecule reaction (e.g., at least 30% in some embodiments), so that single-molecule analysis can be carried out in parallel for a large number of sample wells. In some embodiments, the binding means and the cleaving means are configured to achieve at least 10 association events prior to a cleavage event in at least 10% (e.g., 10-50%, more than 50%, 25-75%, at least 80%, or more) of the sample wells in which a single-molecule reaction is occurring. In some embodiments, the binding means and the cleaving means are configured to achieve at least 10 association events prior to a cleavage event for at least 50% (e.g., more than 50%, 50-75%, at least 80%, or more) of the amino acids of a polypeptide in a single-molecule reaction.

Devices and Systems

[0210]Methods in accordance with the disclosure, in some aspects, may be performed using a system that permits single-molecule analysis. The system may include an integrated device and an instrument configured to interface with the integrated device. The integrated device may include an array of pixels, where individual pixels include a sample well and at least one photodetector. The sample wells of the integrated device may be formed on or through a surface of the integrated device and be configured to receive a sample placed on the surface of the integrated device. Collectively, the sample wells may be considered as an array of sample wells. The plurality of sample wells may have a suitable size and shape such that at least a portion of the sample wells receive a single sample (e.g., a single molecule, such as a polypeptide). In some embodiments, the number of samples within a sample well may be distributed among the sample wells of the integrated device such that some sample wells contain one sample while others contain zero, two or more samples.

[0211]Excitation light is provided to the integrated device from one or more light source external to the integrated device. Optical components of the integrated device may receive the excitation light from the light source and direct the light towards the array of sample wells of the integrated device and illuminate an illumination region within the sample well. In some embodiments, a sample well may have a configuration that allows for the sample to be retained in proximity to a surface of the sample well, which may ease delivery of excitation light to the sample and detection of emission light from the sample. A sample positioned within the illumination region may emit emission light in response to being illuminated by the excitation light. For example, the sample may be labeled with a fluorescent label, which emits light in response to achieving an excited state through the illumination of excitation light. Emission light emitted by a sample may then be detected by one or more photodetectors within a pixel corresponding to the sample well with the sample being analyzed. When performed across the array of sample wells, which may range in number between approximately 10,000 pixels to 1,000,000 pixels according to some embodiments, multiple samples can be analyzed in parallel.

[0212]The integrated device may include an optical system for receiving excitation light and directing the excitation light among the sample well array. The optical system may include one or more grating couplers configured to couple excitation light to other optical components of the integrated device and direct the excitation light to the other optical components. For example, the optical system may include optical components that direct the excitation light from the grating coupler(s) towards the sample well array. Such optical components may include optical splitters, optical combiners, and waveguides. In some embodiments, one or more optical splitters may couple excitation light from a grating coupler and deliver excitation light to at least one of the waveguides. According to some embodiments, the optical splitter may have a configuration that allows for delivery of excitation light to be substantially uniform across all the waveguides such that each of the waveguides receives a substantially similar amount of excitation light. Such embodiments may improve performance of the integrated device by improving the uniformity of excitation light received by sample wells of the integrated device. Examples of suitable components, e.g., for coupling excitation light to a sample well and/or directing emission light to a photodetector, to include in an integrated device are described in U.S. patent application Ser. No. 14/821,688, filed Aug. 7, 2015, titled “INTEGRATED DEVICE FOR PROBING, DETECTING AND ANALYZING MOLECULES,” and U.S. patent application Ser. No. 14/543,865, filed Nov. 17, 2014, titled “INTEGRATED DEVICE WITH EXTERNAL LIGHT SOURCE FOR PROBING, DETECTING, AND ANALYZING MOLECULES,” both of which are incorporated by reference in their entirety. Examples of suitable grating couplers and waveguides that may be implemented in the integrated device are described in U.S. patent application Ser. No. 15/844,403, filed Dec. 15, 2017, titled “OPTICAL COUPLER AND WAVEGUIDE SYSTEM,” which is incorporated by reference in its entirety.

[0213]Additional photonic structures may be positioned between the sample wells and the photodetectors and configured to reduce or prevent excitation light from reaching the photodetectors, which may otherwise contribute to signal noise in detecting emission light. In some embodiments, metal layers which may act as a circuitry for the integrated device, may also act as a spatial filter. Examples of suitable photonic structures may include spectral filters, a polarization filters, and spatial filters and are described in U.S. patent application Ser. No. 16/042,968, filed Jul. 23, 2018, titled “OPTICAL REJECTION PHOTONIC STRUCTURES,” and U.S. Provisional Patent Application No. 63/124,655, filed Dec. 11, 2020, titled “INTEGRATED CIRCUIT WITH IMPROVED CHARGE TRANSFER EFFICIENCY AND ASSOCIATED TECHNIQUES,” both of which are incorporated by reference in their entirety.

[0214]Components located off of the integrated device may be used to position and align an excitation source to the integrated device. Such components may include optical components including lenses, mirrors, prisms, windows, apertures, attenuators, and/or optical fibers. Additional mechanical components may be included in the instrument to allow for control of one or more alignment components. Such mechanical components may include actuators, stepper motors, and/or knobs. Examples of suitable excitation sources and alignment mechanisms are described in U.S. patent application Ser. No. 15/161,088, filed May 20, 2016, titled “PULSED LASER AND SYSTEM,” which is incorporated by reference in its entirety. Another example of a beam-steering module is described in U.S. patent application Ser. No. 15/842,720, filed Dec. 14, 2017, titled “COMPACT BEAM SHAPING AND STEERING ASSEMBLY,” which is incorporated herein by reference. Additional examples of suitable excitation sources are described in U.S. patent application Ser. No. 14/821,688, filed Aug. 7, 2015, titled “INTEGRATED DEVICE FOR PROBING, DETECTING AND ANALYZING MOLECULES,” which is incorporated by reference in its entirety.

[0215]The photodetector(s) positioned with individual pixels of the integrated device may be configured and positioned to detect emission light from the pixel's corresponding sample well. Examples of suitable photodetectors are described in U.S. patent application Ser. No. 14/821,656, filed Aug. 7, 2015, titled “INTEGRATED DEVICE FOR TEMPORAL BINNING OF RECEIVED PHOTONS,” which is incorporated by reference in its entirety. In some embodiments, a sample well and its respective photodetector(s) may be aligned along a common axis. In this manner, the photodetector(s) may overlap with the sample well within the pixel.

[0216]Characteristics of the detected emission light may provide an indication for identifying the label associated with the emission light. Such characteristics may include any suitable type of characteristic, including an arrival time of photons detected by a photodetector, an amount of photons accumulated over time by a photodetector, and/or a distribution of photons across two or more photodetectors. In some embodiments, such characteristics can be any one or a combination of two or more of luminescence lifetime, luminescence intensity, brightness, absorption spectra, emission spectra, luminescence quantum yield, wavelength (e.g., peak wavelength), and signal characteristics (e.g., pulse duration, interpulse durations, change in signal magnitude).

[0217]In some embodiments, a photodetector may have a configuration that allows for the detection of one or more timing characteristics associated with a sample's emission light (e.g., luminescence lifetime). The photodetector may detect a distribution of photon arrival times after a pulse of excitation light propagates through the integrated device, and the distribution of arrival times may provide an indication of a timing characteristic of the sample's emission light (e.g., a proxy for luminescence lifetime). In some embodiments, the one or more photodetectors provide an indication of the probability of emission light emitted by the label (e.g., luminescence intensity). In some embodiments, a plurality of photodetectors may be sized and arranged to capture a spatial distribution of the emission light. Output signals from the one or more photodetectors may then be used to distinguish a label from among a plurality of labels, where the plurality of labels may be used to identify a sample within the sample. In some embodiments, a sample may be excited by multiple excitation energies, and emission light and/or timing characteristics of the emission light emitted by the sample in response to the multiple excitation energies may distinguish a label from a plurality of labels.

[0218]In operation, parallel analyses of samples within the sample wells are carried out by exciting some or all of the samples within the wells using excitation light and detecting signals from sample emission with the photodetectors. Emission light from a sample may be detected by a corresponding photodetector and converted to at least one electrical signal. The electrical signals may be transmitted along conducting lines in the circuitry of the integrated device, which may be connected to an instrument interfaced with the integrated device. The electrical signals may be subsequently processed and/or analyzed. Processing or analyzing of electrical signals may occur on a suitable computing device either located on or off the instrument.

[0219]The instrument may include a user interface for controlling operation of the instrument and/or the integrated device. The user interface may be configured to allow a user to input information into the instrument, such as commands and/or settings used to control the functioning of the instrument. In some embodiments, the user interface may include buttons, switches, dials, and a microphone for voice commands. The user interface may allow a user to receive feedback on the performance of the instrument and/or integrated device, such as proper alignment and/or information obtained by readout signals from the photodetectors on the integrated device. In some embodiments, the user interface may provide feedback using a speaker to provide audible feedback. In some embodiments, the user interface may include indicator lights and/or a display screen for providing visual feedback to a user.

[0220]In some embodiments, the instrument may include a computer interface configured to connect with a computing device. The computer interface may be a USB interface, a FireWire interface, or any other suitable computer interface. A computing device may be any general purpose computer, such as a laptop or desktop computer. In some embodiments, a computing device may be a server (e.g., cloud-based server) accessible over a wireless network via a suitable computer interface. The computer interface may facilitate communication of information between the instrument and the computing device. Input information for controlling and/or configuring the instrument may be provided to the computing device and transmitted to the instrument via the computer interface. Output information generated by the instrument may be received by the computing device via the computer interface. Output information may include feedback about performance of the instrument, performance of the integrated device, and/or data generated from the readout signals of the photodetector.

[0221]In some embodiments, the instrument may include a processing device configured to analyze data received from one or more photodetectors of the integrated device and/or transmit control signals to the excitation source(s). In some embodiments, the processing device may comprise a general purpose processor, a specially-adapted processor (e.g., a central processing unit (CPU) such as one or more microprocessor or microcontroller cores, a field-programmable gate array (FPGA), an application-specific integrated circuit (ASIC), a custom integrated circuit, a digital signal processor (DSP), or a combination thereof). In some embodiments, the processing of data from one or more photodetectors may be performed by both a processing device of the instrument and an external computing device. In other embodiments, an external computing device may be omitted and processing of data from one or more photodetectors may be performed solely by a processing device of the integrated device.

[0222]According to some embodiments, the instrument that is configured to analyze samples based on luminescence emission characteristics may detect differences in luminescence lifetimes and/or intensities between different luminescent molecules, and/or differences between lifetimes and/or intensities of the same luminescent molecules in different environments. The inventors have recognized and appreciated that differences in luminescence emission lifetimes can be used to discern between the presence or absence of different luminescent molecules and/or to discern between different environments or conditions to which a luminescent molecule is subjected. In some cases, discerning luminescent molecules based on lifetime (rather than emission wavelength, for example) can simplify aspects of the system. As an example, wavelength-discriminating optics (such as wavelength filters, dedicated detectors for each wavelength, dedicated pulsed optical sources at different wavelengths, and/or diffractive optics) may be reduced in number or eliminated when discerning luminescent molecules based on lifetime. In some cases, a single pulsed optical source operating at a single characteristic wavelength may be used to excite different luminescent molecules that emit within a same wavelength region of the optical spectrum but have measurably different lifetimes. An analytic system that uses a single pulsed optical source, rather than multiple sources operating at different wavelengths, to excite and discern different luminescent molecules emitting in a same wavelength region can be less complex to operate and maintain, more compact, and may be manufactured at lower cost.

[0223]Although analytic systems based on luminescence lifetime analysis may have certain benefits, the amount of information obtained by an analytic system and/or detection accuracy may be increased by allowing for additional detection techniques. For example, some embodiments of the systems may additionally be configured to discern one or more properties of a sample based on luminescence wavelength and/or luminescence intensity. In some implementations, luminescence intensity may be used additionally or alternatively to distinguish between different luminescent labels. For example, some luminescent labels may emit at significantly different intensities or have a significant difference in their probabilities of excitation (e.g., at least a difference of about 35%) even though their decay rates may be similar. By referencing binned signals to measured excitation light, it may be possible to distinguish different luminescent labels based on intensity levels.

[0224]According to some embodiments, different luminescence lifetimes may be distinguished with a photodetector that is configured to time-bin luminescence emission events following excitation of a luminescent label. The time binning may occur during a single charge-accumulation cycle for the photodetector. A charge-accumulation cycle is an interval between read-out events during which photo-generated carriers are accumulated in bins of the time-binning photodetector. Examples of a time-binning photodetector are described in U.S. patent application Ser. No. 14/821,656, filed Aug. 7, 2015, titled “INTEGRATED DEVICE FOR TEMPORAL BINNING OF RECEIVED PHOTONS,” which is incorporated herein by reference. In some embodiments, a time-binning photodetector may generate charge carriers in a photon absorption/carrier generation region and directly transfer charge carriers to a charge carrier storage bin in a charge carrier storage region. In such embodiments, the time-binning photodetector may not include a carrier travel/capture region. Such a time-binning photodetector may be referred to as a “direct binning pixel.” Examples of time-binning photodetectors, including direct binning pixels, are described in U.S. patent application Ser. No. 15/852,571, filed Dec. 22, 2017, titled “INTEGRATED PHOTODETECTOR WITH DIRECT BINNING PIXEL,” which is incorporated herein by reference.

[0225]In some embodiments, different numbers of fluorophores of the same type may be linked to different reagents in a sample, so that each reagent may be identified based on luminescence intensity. For example, two fluorophores may be linked to a first labeled recognition molecule and four or more fluorophores may be linked to a second labeled recognition molecule. Because of the different numbers of fluorophores, there may be different excitation and fluorophore emission probabilities associated with the different recognition molecules. For example, there may be more emission events for the second labeled recognition molecule during a signal accumulation interval, so that the apparent intensity of the bins is significantly higher than for the first labeled recognition molecule.

[0226]The inventors have recognized and appreciated that distinguishing biological or chemical samples based on fluorophore decay rates and/or fluorophore intensities may enable a simplification of the optical excitation and detection systems. For example, optical excitation may be performed with a single-wavelength source (e.g., a source producing one characteristic wavelength rather than multiple sources or a source operating at multiple different characteristic wavelengths). Additionally, wavelength discriminating optics and filters may not be needed in the detection system. Also, a single photodetector may be used for each sample well to detect emission from different fluorophores. The phrase “characteristic wavelength” or “wavelength” is used to refer to a central or predominant wavelength within a limited bandwidth of radiation (e.g., a central or peak wavelength within a 20 nm bandwidth output by a pulsed optical source). In some cases, “characteristic wavelength” or “wavelength” may be used to refer to a peak wavelength within a total bandwidth of radiation output by a source.

[0227]According to an aspect of the present disclosure, an exemplary integrated device may be configured to perform single-molecule analysis in combination with an instrument as described above. It should be appreciated that the exemplary integrated device described herein is intended to be illustrative and that other integrated device configurations may be configured to perform any or all techniques described herein.

[0228]FIG. 1B illustrates a cross-sectional view of a pixel 1-112 of an integrated device 1-102. Pixel 1-112 includes a photodetection region, which may be a pinned photodiode (PPD), and a charge storage region, which may be a storage diode (SDO). In some embodiments, a photodetection region and charge storage regions may be formed in semiconductor material of a pixel by doping regions of the semiconductor material. For example, the photodetection region and charge storage regions can be formed using a same conductivity type (e.g., n-type doping or p-type doping).

[0229]During operation of pixel 1-112, excitation light may illuminate sample well 1-108 causing incident photons, including fluorescence emissions from a sample, to flow along the optical axis to photodetection region PPD. As shown in FIG. 1B, pixel 1-112 may include a waveguide 1-220 configured to optically (e.g., evanescently) couple excitation light from a grating coupler of the integrated device (not shown) to the sample well 1-108. In response, a sample in the sample well 1-108 may emit fluorescent light toward photodetection region PPD. In some embodiments, pixel 1-112 may also include one or more photonic structures 1-230, which may include one or more optical rejection structures such as a spectral filter, a polarization filter, and/or a spatial filter. For example, the photonic structures 1-230 may be configured to reduce the amount of excitation light that reaches the photodetection region PPD and/or increase the amount of fluorescent emissions that reach the photodetection region PPD. Also shown in pixel 1-112, pixel 1-112 may include one or more metal layers 1-240, which may be configured as a filter and/or may carry control signals from a control circuit configured to control transfer gates, as described further herein.

[0230]In some embodiments, pixel 1-112 may include one or more transfer gates configured to control operation of pixel 1-112 by applying an electrical bias to one or more semiconductor regions of pixel 1-112 in response to one or more control signals. For example, when transfer gate STO induces a first electrical bias at the semiconductor region between photodetection region PPD and storage region SDO, a transfer path (e.g., charge transfer channel) may be formed in the semiconductor region. Charge carriers (e.g., photo-electrons) generated in photodetection region PPD by the incident photons may flow along the transfer path to storage region SDO. In some embodiments, the first electrical bias may be applied during a collection period during which charge carriers from the sample are selectively directed to storage region SDO. Alternatively, when transfer gate STO provides a second electrical bias at the semiconductor region between photodetection region PPD and storage region SDO, charge carriers from photodetection region PPD may be blocked from reaching storage region SDO along the transfer path. In some embodiments, drain gate REJ may provide a channel to drain D to draw noise charge carriers generated in photodetection region PPD by the excitation light away from photodetection region PPD and storage region SDO, such as during a rejection period before fluorescent emission photons from the sample reach photodetection region PPD. In some embodiments, during a readout period, transfer gate STO may provide the second electrical bias and transfer gate TXO may provide an electrical bias to cause charge carriers stored in storage region SDO to flow to the readout region, which may be a floating diffusion (FD) region, for processing.

[0231]It should be appreciated that, in accordance with various embodiments, transfer gates described herein may include semiconductor material(s) and/or metal, and may include a gate of a field effect transistor (FET), a base of a bipolar junction transistor (BJT), and/or the like.

[0232]In some embodiments, operation of pixel 1-112 may include one or more collection sequences, each collection sequence including one or more rejection (e.g., drain) periods and one or more collection periods. In one example, a collection sequence performed in accordance with one or more pulses of an excitation light source may begin with a rejection period, such as to discard charge carriers generated in pixel 1-112 (e.g., in photodetection region PD) responsive to excitation photons from the light source. For instance, the excitation photons may arrive at pixel 1-112 prior to the arrival of fluorescence emission photons from the sample well. Transfer gates for the charge storage regions may be biased to have low conductivity in the charge transfer channels coupling the charge storage regions to the photodetection region, blocking transfer and accumulation of charge carriers in the charge storage regions. A drain gate for the drain region may be biased to have high conductivity in a drain channel between the photodetection region and the drain region, facilitating draining of charge carriers from the photodetection region to the drain region. Transfer gates for any charge storage regions coupled to the photodetection region may be biased to have low conductivity between the photodetection region and the charge storage regions, such that charge carriers are not transferred to or accumulated in the charge storage regions during the rejection period.

[0233]Following the rejection period, a collection period may occur in which charge carriers generated responsive to the incident photons are transferred to one or more charge storage regions. During the collection period, the incident photons may include fluorescent emission photons, resulting in accumulation of fluorescent emission charge carriers in the charge storage region(s). For instance, a transfer gate for one of the charge storage regions may be biased to have high conductivity between the photodetection region and the charge storage region, facilitating accumulation of charge carriers in the charge storage region. Any drain gates coupled to the photodetection region may be biased to have low conductivity between the photodetection region and the drain region such that charge carriers are not discarded during the collection period.

[0234]Some embodiments may include multiple rejection and/or collection periods in a collection sequence, such as a second rejection period and second collection period following a first rejection period and a collection period, where each pair of rejection and collection periods is conducted in response to a pulse of excitation light. In one example, charge carriers generated in the photodetection region during each collection period of a collection sequence (e.g., in response to a plurality of pulses of excitation light) may be aggregated in a single charge storage region. In some embodiments, charge carriers aggregated in the charge storage region may be read out for processing prior to the next collection sequence. Alternatively or additionally, in some embodiments, charge carriers aggregated in a first charge storage region during a first collection sequence may be transferred to a second charge storage region sequentially coupled to the first charge storage region and read out simultaneously with the next collection sequence. In some embodiments, a processing circuit configured to read out charge carriers from one or more pixels may be configured to determine one or more of luminescence intensity information, luminescence lifetime information, luminescence spectral information, and/or any other mode of luminescence information associated with performing techniques described herein.

[0235]In some embodiments, a first collection sequence may include transferring, to a charge storage region at a first time following each excitation pulse, charge carriers generated in the photodetection response in response to the excitation pulse, and a second collection sequence may include transferring, to the charge storage region at a second time following each excitation pulse, charge carriers generated in the photodetection response in response to the excitation pulse. For example, the number of charge carriers aggregated after the first and second times may indicate luminance lifetime information of the received light.

[0236]As described further herein, pixels of an integrated device may be controlled to perform one or more collection sequences using one or more control signals from a control circuit of the integrated circuit, such as by providing the control signal(s) to drain and/or transfer gates of the pixel(s) of the integrated circuit. In some embodiments, charge carriers may be read out from the FD region of each pixel during a readout pixel associated with each pixel and/or a row or column of pixels for processing. In some embodiments, FD regions of the pixels may be read out using correlated double sampling (CDS) techniques.

Sequence Information

[0237]As described herein, in some embodiments, a cleaving reagent of the disclosure comprises an aminopeptidase having an amino acid sequence that shares a percentage of sequence identity with an amino acid sequence selected from Table 1. In some embodiments, a cleaving reagent comprises an aminopeptidase described herein and a tag sequence having an amino acid sequence that shares a percentage of sequence identity with an amino acid sequence selected from Table 2. For the purposes of comparing two or more amino acid sequences, the percentage of “sequence identity” between a first amino acid sequence and a second amino acid sequence (also referred to herein as “amino acid identity”) may be calculated by: dividing [the number of amino acid residues in the first amino acid sequence that are identical to the amino acid residues at the corresponding positions in the second amino acid sequence] by [the total number of amino acid residues in the first amino acid sequence] and multiplying by [100], in which each deletion, insertion, substitution or addition of an amino acid residue in the second amino acid sequence compared to the first amino acid sequence is considered as a difference at a single amino acid residue (position).

[0238]Alternatively, the degree of sequence identity between two amino acid sequences may be calculated using a known computer algorithm (e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. (1970) 48:443, by the search for similarity method of Pearson and Lipman. Proc. Natl. Acad. Sci. USA (1998) 85:2444, or by computerized implementations of algorithms available as Blast, Clustal Omega, or other sequence alignment algorithms) and, for example, using standard settings. Usually, for the purpose of determining the percentage of “sequence identity” between two amino acid sequences in accordance with the calculation method outlined hereinabove, the amino acid sequence with the greatest number of amino acid residues will be taken as the “first” amino acid sequence, and the other amino acid sequence will be taken as the “second” amino acid sequence.

[0239]Additionally, or alternatively, two or more sequences may be assessed for the identity between the sequences. The terms “identical” or percent “identity” in the context of two or more amino acid sequences, refer to two or more sequences or subsequences that are the same. Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues that are the same (e.g., at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical) over a specified region or over the entire sequence, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the above sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 25, 50, 75, or 100 amino acids in length, or over a region that is 100 to 150, 150 to 200, 100 to 200, or 200 or more, amino acids in length.

[0240]Additionally, or alternatively, two or more sequences may be assessed for the alignment between the sequences. The terms “alignment” or “percent alignment” in the context of two or more amino acid sequences, refer to two or more sequences or subsequences that are the same. Two sequences are “substantially aligned” if two sequences have a specified percentage of amino acid residues that are the same (e.g., at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8% or 99.9% identical) over a specified region or over the entire sequence, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the above sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the alignment exists over a region that is at least about 25, 50, 75, or 100 amino acids in length, or over a region that is 100 to 150, 150 to 200, 100 to 200, or 200 or more amino acids in length.

TABLE 1
Non-limiting example sequences of aminopeptidases
SEQ
NameSequenceID NO.
MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT101
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
AminopeptidaseVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEGDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP64MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT102
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEGDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPTGGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFE
AQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIEWHE
MEVRNMVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVI1
AHKKGEGPKVMIAAHMDQIGLMVTHIEKNGFLRVAPIGGVDPKTLIAQRFKVW
AminopeptidaseIDKGKFIYGVGASVPPHIQKPEDRKKAPDWDQIFIDIGAESKEEAEDMGVKIG
(hTET II)TVITWDGRLERLGKHRFVSIAFDDRIAVYTILEVAKQLKDAKADVYFVATVQE
EVGLRGARTSAFGIEPDYGFAIDVTIAADIPGTPEHKQVTHLGKGTAIKIMDR
SVICHPTIVRWLEELAKKHEIPYQLEILLGGGTDAGAIHLTKAGVPTGALSVP
ARYIHSNTEVVDERDVDATVELMTKALENIHELKI
AP30MEVRNMVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVI2
AHKKGEGPKVMIAAHMDQIGLMVTHIEKNGFLRVAPIGGVDPKTLIAQRFKVW
IDKGKFIYGVGASVPPHIQKPEDRKKAPDWDQIFIDIGAESKEEAEDMGVKIG
TVITWDGRLERLGKHRFVSIAFDDRIAVYTILEVAKQLKDAKADVYFVATVQE
EVGLRGARTSAFGIEPDYGFAIDVTIAADIPGTPEHKQVTHLGKGTAIKIMDR
SVICHPTIVRWLEELAKKHEIPYQLEILLGGGTDAGAIHLTKAGVPTGALSVP
ARYIHSNTEVVDERDVDATVELMTKALENIHELKIGGSHHHHHHHHHHGGGSG
GGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIEWHE
MDLKGGESMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLG3
NVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRI
AminopeptidaseRFFTEKGERYGVVGVLPPHLRRGQEDKGSKIDWDQIVVDVGASSKEEAEEMGF
(hTET III)RVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGS
VQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGP
NINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANMQINREGVATAVLSIPIR
YMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
AP37MDLKGGESMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLG4
NVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRI
RFFTEKGERYGVVGVLPPHLRRGQEDKGSKIDWDQIVVDVGASSKEEAEEMGF
RVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGS
VQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGP
NINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANMQINREGVATAVLSIPIR
YMHSQVELADARDVDNTIKLAKALLEELKPMDFTPGHHHHHHHHHH
MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGF5
Xaa-ProlylNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRAL
aminopeptidasePFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPAT
(yPIP)LTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGE
ILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRG
YAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRI
MVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGR
ILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVK
DPDDIEALMALNHAGENLYFQLE
yPIP-6x HisMTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGF6
NEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRAL
PFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPAT
LTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGE
ILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRG
YAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRI
MVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGR
ILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVK
DPDDIEALMALNHAGENLYFQLEHHHHHH
yPIP (truncated)MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGF7
NEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRAL
PFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPAT
LTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGE
ILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRG
YAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRI
MVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGR
ILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVK
DPDDIEALMALNHAGENLYFQ
AP70MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGF8
NEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRAL
PFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPAT
LTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGE
ILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRG
YAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRI
MVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGR
ILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVK
DPDDIEALMALNHAGENLYFQGGSHHHHHH
MMVKQGVFMKTDQSKVKKLSDYKSLDYFVIHVDLQIDLSKKPVESKARLTVVP9
M1NLNVDSHSNDLVLDGENMTLVSLQMNDNLLKENEYELTKDSLIIKNIPQNTPF
AminopeptidaseTIEMTSLLGENTDLFGLYETEGVALVKAESEGLRRVFYLPDRPDNLATYKTTI
(Glu/Asp Specific)IANQEDYPVLLSNGVLIEKKELPLGLHSVTWLDDVPKPSYLFALVAGNLQRSV
TYYQTKSGRELPIEFYVPPSATSKCDFAKEVLKEAMAWDERTFNLECALRQHM
VAGVDKYASGASEPTGLNLFNTENLFASPETKTDLGILRVLEVVAHEFFHYWS
GDRVTIRDWFNLPLKEGLTTFRAAMFREELFGTDLIRLLDGKNLDERAPRQSA
YTAVRSLYTAAAYEKSADIFRMMMLFIGKEPFIEAVAKFFKDNDGGAVTLEDF
IESISNSSGKDLRSFLSWFTESGIPELIVTDELNPDTKQYFLKIKTVNGRNRP
IPILMGLLDSSGAEIVADKLLIVDQEEIEFQFENIQTRPIPSLLRSFSAPVHM
KYEYSYQDLLLLMQFDTNLYNRCEAAKQLISALINDFCIGKKIELSPQFFAVY
KALLSDNSLNEWMLAELITLPSLEELIENQDKPDFEKLNEGRQLIQNALANEL
KTDFYNLLFRIQISGDDDKQKLKGFDLKQAGLRRLKSVCFSYLLNVDFEKTKE
KLILQFEDALGKNMTETALALSMLCEINCEEADVALEDYYHYWKNDPGAVNNW
FSIQALAHSPDVIERVKKLMRHGDFDLSNPNKVYALLGSFIKNPFGFHSVTGE
GYQLVADAIFDLDKINPTLAANLTEKFTYWDKYDVNRQAMMISTLKIIYSNAT
SSDVRTMAKKGLDKVKEDLPLPIHLTFHGGSTMQDRTAQLIADGNKENAYQLH
MGTAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVN10
aminopeptidaseEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
(Met specific)FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFV
EAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG
KKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
MGTLEANTNGPGSMLSRMPVSSRTVPFGDHETWVQVTTPENAQPHALPLIVLH11
ProlineGGPGMAHNYVANIAALADETGRTVIHYDQVGCGNSTHLPDAPADFWTPQLFVD
iminopeptidaseEFHAVCTALGIERYHVLGQSWGGMLGAEIAVRQPSGLVSLAICNSPASMRLWS
(Pro specific)EAAGDLRAQLPAETRAALDRHEAAGTITHPDYLQAAAEFYRRHVCRVVPTPQD
FADSVAQMEAEPTVYHTMNGPNEFHVVGTLGDWSVIDRLPDVTAPVLVIAGEH
DEATPKTWQPFVDHIPDVRSHVFPGTSHCTHLEKPEEFRAVVAQFLHQHDLAA
DARV
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVN12
methionineLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDE
aminopeptidaseLMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYK
LHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDV
PVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGY
PVLKEIRNGIVAQFEHTIIVEKDSVIVTQDMINKSTLE
HMSSPLHYVLDGIHCEPHFFTVPLDHQQPDDEETITLFGRTLCRKDRLDDELP13
ProlineWLLYLQGGPGFGAPRPSANGGWIKRALQEFRVLLLDQRGTGHSTPIHAELLAH
aminopeptidaseLNPRQQADYLSHFRADSIVRDAELIREQLSPDHPWSLLGQSFGGFCSLTYLSL
FPDSLHEVYLTGGVAPIGRSADEVYRATYQRVADKNRAFFARFPHAQAIANRL
ATHLQRHDVRLPNGQRLTVEQLQQQGLDLGASGAFEELYYLLEDAFIGEKLNP
AFLYQVQAMQPFNTNPVFAILHELIYCEGAASHWAAERVRGEFPALAWAQGKD
FAFTGEMIFPWMFEQFRELIPLKEAAHLLAEKADWGPLYDPVQLARNKVPVAC
AVYAEDMYVEFDYSRETLKGLSNSRAWITNEYEHNGLRVDGEQILDRLIRLNR
DCLE
MKERLEKLVKFMDENSIDRVFIAKPVNVYYFSGTSPLGGGYIIVDGDEATLYV14
PELEYEMAKEESKLPVVKFKKFDEIYEILKNTETLGIEGTLSYSMVENFKEKS
AminopeptidaseNVKEFKKIDDVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKRERE
(X-/-Pro)VAAKVEYLMKMNGAEKPAFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGA
LYNHYNSDITRTIVVGSPNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIA
REIIKEYGYGDYFIHSLGHGVGLEIHEWPRISQYDETVLKEGMVITIEPGIYI
PKLGGVRIEDTVLITENGAKRLTKTERELL
MIPITTPVGNFKVWTKRFGTNPKIKVLLLHGGPAMTHEYMECFETFFQREGFE15
FYEYDQLGSYYSDQPTDEKLWNIDRFVDEVEQVRKAIHADKENFYVLGNSWGG
ProlineILAMEYALKYQQNLKGLIVANMMASAPEYVKYAEVLSKQMKPEVLAEVRAIEA
aminopeptidaseKKDYANPRYTELLFPNYYAQHICRLKEWPDALNRSLKHVNSTVYTLMQGPSEL
GMSSDARLAKWDIKNRLHEIATPTLMIGARYDTMDPKAMEEQSKLVQKGRYLY
CPNGSHLAMWDDQKVFMDGVIKFIKDVDTKSFN
MYEIKQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFF16
ProlineNPDVFRIVIIDQRGCGRSHPYACAEDNTTWDLVADIEKVREMLGIGKWLVFGG
IminopeptidaseSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETAWLNEAGGVSRIYPEQWQK
FVAPIAENRRNRLIEAYHGLLFHQDEEVCLSAAKAWADWESYLIRFEPEGVDE
DAYASLAIARLENHYFVNGGWLQGDKAILNNIGKIRHIPTVIVQGRYDLCTPM
QSAWELSKAFPEAELRVVQAGHCAFDPPLADALVQAVEDILPRLL
MTQQPQAKYRHDYRAPDYQITDIDLTFDLDAQKTVVTAVSQAVRHGASDAPLR17
Aminopeptidase NLNGEDLKLVSVHINDEPWTAWKEEEGALVISNLPERFTLKIINEISPAANTAL
(ZincEGLYQSGDALCTQCEAEGFRHITYYLDRPDVLARFTTKIIADKIKYPFLLSNG
Metalloprotease)NRVAQGELENGRHWVQWQDPFPKPCYLFALVAGDFDVLRDTFTTRSGREVALE
LYVDRGNLDRAPWAMTSLKNSMKWDEERFGLEYDLDIYMIVAVDFFNMGAMEN
KGLNIFNSKYVLARTDTATDKDYLDIERVIGHEYFHNWTGNRVTCRDWFQLSL
KEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDASPMAHPIRPDMVIE
MNNFYTLTVYEKGAEVIRMIHTLLGEENFQKGMQLYFERHDGSAATCDDFVQA
MEDASNVDLSHFRRWYSQSGTPIVTVKDDYNPETEQYTLTISQRTPATPDQAE
KQPLHIPFAIELYDNEGKVIPLQKGGHPVNSVLNVTQAEQTFVFDNVYFQPVP
ALLCEFSAPVKLEYKWSDQQLTFLMRHARNDFSRWDAAQSLLATYIKLNVARH
QQGQPLSLPVHVADAFRAVLLDEKIDPALAAEILTLPSVNEMAELFDIIDPIA
IAEVREALTRTLATELADELLAIYNANYQSEYRVEHEDIAKRTLRNACLRFLA
FGETHLADVLVSKQFHEANNMTDALAALSAAVAAQLPCRDALMQEYDDKWHQN
GLVMDKWFILQATSPAANVLETVRGLLQHRSFTMSNPNRIRSLIGAFAGSNPA
AFHAEDGSGYLFLVEMLTDLNSRNPQVASRLIEPLIRLKRYDAKRQEKMRAAL
EQLKGLENLSGDLYEKITKALA
PKIHYRKDYKPSGFIINQVTLNINIHDQETIVRSVLDMDISKHNVGEDLVFDG18
aminopeptidaseVGLKINEISINNKKLVEGEEYTYDNEFLTIFSKFVPKSKFAFSSEVIIHPETN
YALTGLYKSKNIIVSQCEATGFRRITFFIDRPDMMAKYDVTVTADKEKYPVLL
SNGDKVNEFEIPGGRHGARFNDPPLKPCYLFAVVAGDLKHLSATYITKYTKKK
VELYVFSEEKYVSKLQWALECLKKSMAFDEDYFGLEYDLSRLNLVAVSDFNVG
AMENKGLNIFNANSLLASKKNSIDFSYARILTVVGHEYFHQYTGNRVTLRDWF
QLTLKEGLTVHRENLFSEEMTKTVTTRLSHVDLLRSVQFLEDSSPLSHPIRPE
SYVSMENFYTTTVYDKGSEVMRMYLTILGEEYYKKGFDIYIKKNDGNTATCED
FNYAMEQAYKMKKADNSANLNQYLLWFSQSGTPHVSFKYNYDAEKKQYSIHVN
QYTKPDENQKEKKPLFIPISVGLINPENGKEMISQTTLELTKESDTFVFNNIA
VKPIPSLFRGFSAPVYIEDQLTDEERILLLKYDSDAFVRYNSCTNIYMKQILM
NYNEFLKAKNEKLESFQLTPVNAQFIDAIKYLLEDPHADAGFKSYIVSLPQDR
YIINFVSNLDTDVLADTKEYIYKQIGDKLNDVYYKMFKSLEAKADDLTYFNDE
SHVDFDQMNMRTLRNTLLSLLSKAQYPNILNEIIEHSKSPYPSNWLTSLSVSA
YFDKYFELYDKTYKLSKDDELLLQEWLKTVSRSDRKDIYEILKKLENEVLKDS
KNPNDIRAVYLPFTNNLRRFHDISGKGYKLIAEVITKTDKFNPMVATQLCEPF
KLWNKLDTKRQELMLNEMNTMLQEPQISNNLKEYLLRLTNK
Puromycin-MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFER19
sensitiveLPADVSPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITAS
aminopeptidaseYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGF
(NPEPPS)YRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDRVA
LSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVC
VRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAM
ENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHL
WLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVG
HPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATED
LWESLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGG
SYVGEDCPQWMVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNL
GTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEV
LKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGER
LGWDPKPGEGHLDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSAD
LRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKV
LTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLI
SRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRD
AESIHQYLLQRKASPPTV
NPEPPS E366VMWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFER20
LPADVSPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITAS
YAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGF
YRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDRVA
LSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVC
VRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAM
ENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHVLAHQWFGNLVTMEWWTHL
WLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVG
HPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATED
LWESLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGG
SYVGEDCPQWMVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNL
GTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEV
LKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGER
LGWDPKPGEGHLDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSAD
LRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKV
LTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLI
SRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRD
AESIHQYLLQRKASPPTV
MIYEFVMTDPKIKYLKDYKPSNYLIDETHLIFELDESKTRVTANLYIVANREN21
RENNTLVLDGVELKLLSIKLNNKHLSPAEFAVNENQLIINNVPEKFVLQTVVE
Aminopeptidase NINPSANTSLEGLYKSGDVFSTQCEATGFRKITYYLDRPDVMAAFTVKIIADKK
KYPIILSNGDKIDSGDISDNQHFAVWKDPFKKPCYLFALVAGDLASIKDTYIT
KSQRKVSLEIYAFKQDIDKCHYAMQAVKDSMKWDEDRFGLEYDLDTFMIVAVP
DFNAGAMENKGLNIFNTKYIMASNKTATDKDFELVQSVVGHEYFHNWTGDRVT
CRDWFQLSLKEGLTVFRDQEFTSDLNSRDVKRIDDVRIIRSAQFAEDASPMSH
PIRPESYIEMNNFYTVTVYNKGAEIIRMIHTLLGEEGFQKGMKLYFERHDGQA
VTCDDFVNAMADANNRDFSLFKRWYAQSGTPNIKVSENYDASSQTYSLTLEQT
TLPTADQKEKQALHIPVKMGLINPEGKNIAEQVIELKEQKQTYTFENIAAKPV
ASLFRDFSAPVKVEHKRSEKDLLHIVKYDNNAFNRWDSLQQIATNIILNNADL
NDEFLNAFKSILHDKDLDKALISNALLIPIESTIAEAMRVIMVDDIVLSRKNV
VNQLADKLKDDWLAVYQQCNDNKPYSLSAEQIAKRKLKGVCLSYLMNASDQKV
GTDLAQQLFDNADNMTDQQTAFTELLKSNDKQVRDNAINEFYNRWRHEDLVVN
KWLLSQAQISHESALDIVKGLVNHPAYNPKNPNKVYSLIGGFGANFLQYHCKD
GLGYAFMADTVLALDKFNHQVAARMARNLMSWKRYDSDRQAMMKNALEKIKAS
NPSKNVFEIVSKSLES
MDAFTENLNKLAELAIRVGLNLEEGQEIVATAPIEAVDFVRLLAEKAYENGAS22
Aminopeptidase TLFTVLYGDNLIARKRLALVPEAHLDRAPAWLYEGMAKAFHEGAARLAVSGNDP
KALEGLPPERVGRAQQAQSRAYRPTLSAITEFVTNWTIVPFAHPGWAKAVFPG
LPEEEAVQRLWQAIFQATRVDQEDPVAAWEAHNRVLHAKVAFLNEKRFHALHF
QGPGTDLTVGLAEGHLWQGGATPTKKGRLCNPNLPTEEVFTAPHRERVEGVVR
ASRPLALSGQLVEGLWARFEGGVAVEVGAEKGEEVLKKLLDTDEGARRLGEVA
LVPADNPIAKTGLVFFDTLFDENAASHIAFGQAYAENLEGRPSGEEFRRRGGN
ESMVHVDWMIGSEEVDVDGLLEDGTRVPLMRRGRWVI
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAK23
KEGKSGGPKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIV
Peptidase M28TKKGDITGVIGSKPPHILPSEARKKPVEIKDMFIDIGATSREEAMEWGVRPGD
MIVPYFEFTVLNNEKMLLAKAWDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTV
QEEVGLRGARTAAQFIQPDIAFAVDVGIAGDTPGVSEKEAMGKLGAGPHIVLY
DATMVSHRGLREFVIEVAEELNIPHHFDAMPGVGTDAGAIHLTGIGVPSLTIA
IPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTFDE
MEDKVWISMGADAVGSLNPALSESLLPHSFASGSQVWIGEVAIDELAELSHTM24
AminopeptidaseHEQHNRCGGYMVHTSAQGAMAALMMPESIANFTIPAPSQQDLVNAWLPQVSAD
QITNTIRALSSFNNRFYTTTSGAQASDWLANEWRSLISSLPGSRIEQIKHSGY
NQKSVVLTIQGSEKPDEWVIVGGHLDSTLGSHTNEQSIAPGADDDASGIASLS
EIIRVLRDNNFRPKRSVALMAYAAEEVGLRGSQDLANQYKAQGKKVVSVLQLD
MTNYRGSAEDIVFITDYTDSNLTQFLTTLIDEYLPELTYGYDRCGYACSDHAS
WHKAGFSAAMPFESKFKDYNPKIHTSQDTLANSDPTGNHAVKFTKLGLAYVIE
MANAGSSQVPDDSVLQDGTAKINLSGARGTQKRFTFELSQSKPLTIQTYGGSG
DVDLYVKYGSAPSKSNWDCRPYQNGNRETCSFNNAQPGIYHVMLDGYTNYNDV
ALKASTQ
MEDKVWISIGSDASQTVKSVMQSNARSLLPESLASNGPVWVGQVDYSQLAELS25
HHMHEDHQRCGGYMVHSSPESAIAASNMPQSLVAFSIPEISQQDTVNAWLPQV
AminopeptidaseNSQAITGTITSLTSFINRFYTTTSGAQASDWLANEWRSLSASLPNASVRQVSH
FGYNQKSVVLTITGSEKPDEWIVLGGHLDSTIGSHTNEQSVAPGADDDASGIA
SVTEIIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKAEGKQVISAL
QLDMTNYKGSVEDIVFITDYTDSNLTTFLSQLVDEYLPSLTYGFDTCGYACSD
HASWHKAGFSAAMPFEAKFNDYNPMIHTPNDTLQNSDPTASHAVKFTKLGLAY
AIEMASTTGGTPPPTGNVLKDGVPVNGLSGATGSQVHYSFELPAQKNLQISTA
GGSGDVDLYVSFGSEATKQNWDCRPYRNGNNEVCTFAGATPGTYSIMLDGYRQ
FSGVTLKASTQ
MTQQPQAKYRHDYRAPDYTITDIDLDFALDAQKTTVTAVSKVKRQGTDVTPLI26
Aminopeptidase NLNGEDLTLISVSVDGQAWPHYRQQDNTLVIEQLPADFTLTIVNDIHPATNSAL
EGLYLSGEALCTQCEAEGFRHITYYLDRPDVLARFTTRIVADKSRYPYLLSNG
NRVGQGELDDGRHWVKWEDPFPKPSYLFALVAGDFDVLQDKFITRSGREVALE
IFVDRGNLDRADWAMTSLKNSMKWDETRFGLEYDLDIYMIVAVDFFNMGAMEN
KGLNVFNSKYVLAKAETATDKDYLNIEAVIGHEYFHNWTGNRVTCRDWFQLSL
KEGLTVFRDQEFSSDLGSRSVNRIENVRVMRAAQFAEDASPMAHAIRPDKVIE
MNNFYTLTVYEKGSEVIRMMHTLLGEQQFQAGMRLYFERHDGSAATCDDFVQA
MEDVSNVDLSLFRRWYSQSGTPLLTVHDDYDVEKQQYHLFVSQKTLPTADQPE
KLPLHIPLDIELYDSKGNVIPLQHNGLPVHHVLNVTEAEQTFTFDNVAQKPIP
SLLREFSAPVKLDYPYSDQQLTFLMQHARNEFSRWDAAQSLLATYIKLNVAKY
QQQQPLSLPAHVADAFRAILLDEHLDPALAAQILTLPSENEMAELFTTIDPQA
ISTVHEAITRCLAQELSDELLAVYVANMTPVYRIEHGDIAKRALRNTCLNYLA
FGDEEFANKLVSLQYHQADNMTDSLAALAAAVAAQLPCRDELLAAFDVRWNHD
GLVMDKWFALQATSPAANVLVQVRTLLKHPAFSLSNPNRTRSLIGSFASGNPA
AFHAADGSGYQFLVEILSDLNTRNPQVAARLIEPLIRLKRYDAGRQALMRKAL
EQLKTLDNLSGDLYEKITKALAA
MEEKVWISIGGDATQTALRSGAQSLLPENLINQTSVWVGQVPVSELATLSHEM27
HENHQRCGGYMVHPSAQSAMSVSAMPLNLNAFSAPEITQQTTVNAWLPSVSAQ
AminopeptidaseQITSTITTLTQFKNRFYTTSTGAQASNWIADHWRSLSASLPASKVEQITHSGY
NQKSVMLTITGSEKPDEWVVIGGHLDSTLGSRTNESSIAPGADDDASGIAGVT
EIIRLLSEQNFRPKRSIAFMAYAAEEVGLRGSQDLANRFKAEGKKVMSVMQLD
MTNYQGSREDIVFITDYTDSNFTQYLTQLLDEYLPSLTYGFDTCGYACSDHAS
WHAVGYPAAMPFESKFNDYNPNIHSPQDTLQNSDPTGFHAVKFTKLGLAYVVE
MGNASTPPTPSNQLKNGVPVNGLSASRNSKTWYQFELQEAGNLSIVLSGGSGD
ADLYVKYQTDADLQQYDCRPYRSGNNETCQFSNAQPGRYSILLHGYNNYSNAS
LVANAQ
MEDKKVWISIGADAQQTALSSGAQPLLAQSVAHNGQAWIGEVSESELAALSHE28
spYCSC6MHENHHRCGGYIVHSSAQSAMAASNMPLSRASFIAPAISQQALVTPWISQIDS
AminopeptidaseALIVNTIDRLTDFPNRFYTTTSGAQASDWIKQRWQSLSAGLAGASVTQISHSG
YNQASVMLTIEGSESPDEWVVVGGHLDSTIGSRTNEQSIAPGADDDASGIAAV
TEVIRVLAQNNFQPKRSIAFVAYAAEEVGLRGSQDVANQFKQAGKDVRGVLQL
DMTNYQGSAEDIVFITDYTDNQLTQYLTQLLDEYLPTLNYGFDTCGYACSDHA
SWHQVGYPAAMPFEAKFNDYNPNIHTPQDTLANSDSEGAHAAKFTKLGLAYTV
ELANADSSPNPGNELKLGEPINGLSGARGNEKYFNYRLDQSGELVIRTYGGSG
DVDLYVKANGDVSTGNWDCRPYRSGNDEVCRFDNATPGNYAVMLRGYRTYDNV
SLIVE
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEW29
QALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHT
Aminopeptidase INEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQ
DLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEY
LPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANS
DPTGSHAKKFTQLGLAYAIEMGSATGDTPTPGNQLE
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEW30
QFLSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHT
Aminopeptidase INEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQ
(A55F)DLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEY
LPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANS
DPTGSHAKKFTQLGLAYAIEMGSATGDTPTPGNQLE
MVDWELMKKIIESPGVSGYEHLGIRDLVVDILKDVADEVKIDKLGNVIAHFKG31
Aminopeptidase ISAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKGE
RYGVVGVLPPHLRREAKDQGGKIDWDSIIVDVGASSREEAEEMGFRIGTIGEF
APNFTRLSEHRFATPYLDDRICLYAMIEAARQLGEHEADIYIVASVQEEIGLR
GARVASFAIDPEVGIAMDVTFAKQPNDKGKIVPELGKGPVMDVGPNINPKLRQ
FADEVAKKYEIPLQVEPSPRPTGTDANVMQINREGVATAVLSIPIRYMHSQVE
LADARDVDNTIKLAKALLEELKPMDFTPLE
AP87MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT103
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIQTEGDGRSDHAPFKN
VGVPVGGLWTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP88MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT104
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIQTEGDGRSDHAPFKN
VGVPVGGLYTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP89MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT105
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEINTEGDGRSDHAPFKN
VGVPVGGLWTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP90MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT106
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEINTEGDGRSDHAPFKN
VGVPVGGLYTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP101MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT107
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIQTQGNGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP102MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT108
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEILTEGDGRSDHAPFKN
VGVPVGGLMTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP103MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT109
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP104MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT110
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLDTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP188MPAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGY111
TTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSA
AVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGY
LNFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIQTEGDGRSDHAPFK
NVGVPVGGLYTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALD
RNSDAAAHAIWTLSSGTGEPPT
AP190MPAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGY112
TTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSA
AVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGY
LNFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFK
NVGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALD
RNSDAAAHAIWTLSSGTGEPPT
AP192MPAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGY113
TTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSA
AVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGY
LNFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEISTEGDGRSDHAPFK
NVGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALD
RNSDAAAHAIWTLSSGTGEPPT
AP196MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT114
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEISTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP197MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT115
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEITTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP198MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT116
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDLIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP199MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT117
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDIIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP200MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT118
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDFIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP201MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT119
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDYIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP202MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT120
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEADGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP203MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT121
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEFDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP204MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT122
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTELDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP205MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT123
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEIDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP206MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT124
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEVDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP207MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT125
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGFGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP208MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT126
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGLGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP209MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT127
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGIGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP210MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT128
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGVGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP211MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT129
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP212MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT130
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEFDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP213MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT131
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEYDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP214MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT132
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETELDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP215MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT133
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEIDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP216MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT134
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEVDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP217MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT135
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEMDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP218MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT136
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETENDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP219MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT137
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEHDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP220MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT138
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEEDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP221MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT139
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEYDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP222MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT140
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEMDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP223MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT141
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTENDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP224MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT142
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEHDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP225MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT143
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEEDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP95MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFT144
HPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYY
MSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPS
RELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHA
QLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQA
FIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKN
NQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDC
LALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGH
YLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDD
VVVTQDSPLILSADCPKEMNDIEQICSQAS
MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA150
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
AminopeptidaseGKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVDHEGDG
RSDHAPFQNVGIPVGGLFSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP112MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA151
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVMHEGDG
RSDHAPFQNVGIPVGGLWSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP113MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA152
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVFHEGDG
RSDHAPFQNVGIPVGGLDSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP114MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA153
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVLHEGDG
RSDHAPFQNVGIPVGGLESGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP115MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA154
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVSHEGDG
RSDHAPFQNVGIPVGGLESGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP116MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA155
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVVHEGDG
RSDHAPFQNVGIPVGGLDSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP117MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA156
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVVHEGDG
RSDHAPFQNVGIPVGGLESGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP119MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA157
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVLHEGDG
RSDHAPFQNVGIPVGGLMSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP120MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA158
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVVHEGDG
RSDHAPFQNVGIPVGGLNSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP121MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA159
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVSHEGDG
RSDHAPFQNVGIPVGGLNSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP122MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA160
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVQHEGDG
RSDHAPFQNVGIPVGGLDSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP123MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA161
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVNHEGDG
RSDHAPFQNVGIPVGGLDSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP124MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA162
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVHHEGDG
RSDHAPFQNVGIPVGGLDSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP125MLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATTA163
AAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYVK
GKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPGI
NDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSSA
DRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVHHEGDG
RSDHAPFQNVGIPVGGLNSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTYA
NLNDTALGTNTDAIAGAVWSLSGSATS
AP194MPLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATT164
AAAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYV
KGKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPG
INDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSS
ADRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVVHEGD
GRSDHAPFQNVGIPVGGLNSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTY
ANLNDTALGTNTDAIAGAVWSLSGSATS
AP195MPLELNGPLNGPARRSRAVALLATGAALAATLLGTASGAADAVPTTAKTTATT165
AAAKGHVRTKAGAPAIPVANVKAHLNQLQSIARANNGNRAHGRSGYKASVDYV
KGKLDAAGFTTTVQQFSANGATGYNLIADWPGGDTDHVVFAGSHLDSVSAGPG
INDNGSGSAGVLEVALAVAREGYKPDKHLRFGWWGAEELGMVGSQNYVDNLSS
ADRSKIDAYLNFDMIGSPNPGYYVYGYDANLQSLFENWFAAKNIATEVSHEGD
GRSDHAPFQNVGIPVGGLNSGADYIKTAEQAQKWGGTAGRAFDACYHRSCDTY
ANLNDTALGTNTDAIAGAVWSLSGSATS
TABLE 2
Non-limiting examples of tag sequences.
SEQ
DescriptionSequenceID NO:
6x His-tagHHHHHH32
6x His-tag with linkerGGSHHHHHH33
10x His-tagHHHHHHHHHH34
10x His-tag withGHHHHHHHHHH35
linker
Biotinylation tagGLNDFFEAQKIEWHE36
Biotinylation tag withGGGSGLNDFFEAQKIEWHE37
linker
Biotinylation tag withGGGSGGGSGGGSGLNDFFEAQKIEWHE38
linker
Bis-biotinylation tagGGGSGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIE39
with linkersWHE
Bis-biotinylation tagGSGGGSGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGSGLNDFFEAQK40
with linkersIEWHE
His/biotinylation tagsGHHHHHHHHHHGGGSGGGSGGGSGLNDFFEAQKIEWHE41
with linkers
His/bis-biotinylationGHHHHHHHHHHGGGGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGSG42
tags with linkersLNDFFEAQKIEWHE
His/bis-biotinylationGGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGG43
tags with linkersSGLNDFFEAQKIEWHE
His/bis-biotinylationGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGS44
tags with linkersGLNDFFEAQKIEWHE
Bis-biotinylation/HisGGGSGGGSGGGSGLNDFFEAQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIE45
tags with linkersWHEGHHHHHH

EXAMPLES

Example 1. Evaluation of Pyrococcus horikoshii TET II Aminopeptidases

[0241]Cutting performance was evaluated with peptide substrates extended at the C-terminal end by the addition of a tripeptide DDD motif. FIGS. 2A-2D show TET aminopeptidase performance improvement by extending the C terminal of the peptide with DDD motif. The bar charts in FIGS. 2A-2D show the beneficial effect of extension of C terminal with DDD peptide motif on kinetics of hTETII/PfuTET combination (at 1 μM/40 μM) with QP514 (DQQRLIFAYPDDD) (SEQ ID NO: 49) and control QP434 (DQQRLIFAG (SEQ ID NO: 373), without the DDD motif) peptides. Plots are shown for cut depth (FIG. 2A), cleavage activity (% of reads reaching the last visible RS) (FIG. 2B), time taken to cleave DQQ motif and R residue (FIG. 2C), and % of 4+RSs (FIG. 2D).

[0242]Cutting performance was evaluated for AP30, a cleaving reagent comprising Pyrococcus horikoshii TET II Aminopeptidase (hTET II) and a C-terminal tag. AP30 was expressed in E. coli, and the cell free extract was prepared after the cell lysis and resolved in talon affinity column in AKTA. FIG. 3A shows an example chromatogram showing AP30 separation and the eluted peak.

[0243]FIG. 3B (left image) shows Talon affinity column purification fractions resolved on SDS PAGE gel to show AP30 enrichment. The eluted peak fractions with majority monomer (45.83 kDa) are shown with an arrow. Other bands above the monomer are different complexes of AP30 under the condition. FIG. 3B (right image) shows the native gel showing hTETII and AP30 protein profiles before and after conditioning (complex formation at 65° C. in the presence of cobalt acetate for 30 minutes, which yields mostly dodecameric complex). AP30 shows more uniform higher order complex formation.

[0244]A real-time cleavage kinetics assay was performed using amino acid-AMC (7-Amino-4-methylcoumarin) substrates, with cleavage kinetics followed in real time at excitation wavelength of 357 nm and emission wavelength of 450 nm, at 30° C. to measure the increase in fluorescence at 441 nm. FIG. 4 shows three bar charts comparing the inherent cleavage rates and substrate specificities by hTETII and AP30 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart). The inherent cleavage rates were derived for each residue at an optimal concentration of aminopeptidase which were determined by aminopeptidase titration. The rates were calculated by exponential fits of the intensity change of the time course. These results showed that AP30 has slower inherent cleavage rates than hTETII for individual amino acids.

[0245]A protein sequencing assay was performed with AP30 cutter (5 PM), PS610 (50 nM) recognizer and QP47 peptide (FAAAYPDDD) (SEQ ID NO: 46). FIG. 5A shows a representative trace showing the first RS and the last RS recognition by PS610 as the cleavage progressed. FIG. 5B shows plots showing the mean cleavage times for FA (left plot) and YP (right plot) RSs. FIG. 5C shows a plot showing the rapid sequential cleavage population and regular cleavage population. The RSC population with AP30 was only ˜25%, which was lower compared to hTETII. These results showed that AP30 shows a smaller population of rapid sequential cleavage (RSC) than hTETII.

[0246]A protein sequencing assay was performed with 1 μM hTETII cutter, PS610 (50 nM) recognizer and QP47 peptide (FAAAYPDDD) (SEQ ID NO: 46). FIG. 6A shows a representative trace showing the first and the last RSs by PS610 as the cleavage progressed.

[0247]FIG. 6B shows plots showing the mean cleavage times for FA and YP RSs. FIG. 6C shows a plot showing the rapid sequential cleavage population and regular cleavage population. RSC population is ˜40%. These results showed that hTETII has a larger population of rapid repetitive cleavage (RSC) than AP30.

[0248]A protein sequencing assay was performed with AP30 (1 PM)/PfuTET (40 PM), an alternate cutter combination, along with PS610 (50 nM), PS557 (250 nM) and PS621 (250 nM) recognizers and QP433 peptide (RLIFAYPDDD) (SEQ ID NO: 47). FIG. 7A shows a representative trace showing the five RSs identified by the recognizers as the cleavage progressed. FIG. 7B shows a Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs (top plot), and plots showing the cut depths and proportion of each RS recognized in the reads with (middle plot) and without (bottom plot) gap (no missed recognizable residue).

[0249]A protein sequencing assay was performed with AP30 (3 μM) or hTETII (2 μM)/PfuTET (40 μM) aminopeptidase combination, along with P610 (50 nM) and PS557 (250 nM) recognizers and QP425 (LASSIAEANRFADIADYP) (SEQ ID NO: 48) on the same chip. FIG. 8A shows representative traces for reactions with AP30 and hTETII showing RSs identified by the recognizers as the cleavage progressed. FIG. 8B shows plots showing cut depths and proportions of each RS recognized in the reads without gap (no missed recognizable residue).

[0250]FIGS. 9A-9C illustrate that AP30 improved cutting performance by increasing cleavage activity and reducing rapid sequential cleavage. The bar charts in FIGS. 9A-9C show the improvements of cut depth (FIG. 9A) and % of 4+RSs reads (FIG. 9B) at different AP30 concentrations with 40 μM pfuTET, PS610 (50 nM) and PS557 (250 nM) recognizers on QP425 (LASSIAEANRFADIADYP) (SEQ ID NO: 48). The change was calculated relative to hTETII tested at the same concentration on the same chip. AP30 reduces rapid sequential cleavage of IA and FA RSs (FIG. 9C). The Cleavage activity was also improved in the chip readout because the number of useful reads (4+RSs) increased with AP30/PfuTET combination.

[0251]Tables 3 and 4 show example results from these studies showing that AP30 improved cutting performance (cut depth and % of useful reads) by increasing cleavage activity and reducing rapid sequential cleavage.

TABLE 3
Results from studies evaluating cutting performance
cutcutLA-IA-
depthdepthLA-FA4+ RS
(10%(%IA-(%(%
Peptideexp/ctrlhTETII/AP30PfuTETreads)change)FAchange)4+ RSchange)
QP425ctrlhTETII40 μM7.583.521.93
(2 μM)
QP425expAP3040 μM9.3223%5.3652%2.6537%
(2 μM)
QP425ctrlhTETII40 μM4.70.810.28
(3 μM)
QP425expAP3040 μM5.1710%1.4275%0.5182%
(3 μM)
QP425ctrlhTETII40 μM5.321.720.5
(5 μM)
QP425expAP3040 μM613%2.649%0.860%
(5 μM)
TABLE 4
Results from studies evaluating cutting performance (continued from Table 3)
cleavageIA RSFA RS
activitymissingmissing
cleavage(%IA RS(%FA RS(%
Peptideexp/ctrlhTETII/AP30PfuTETactivityincrease)missingchange)missingchange)
QP425ctrlhTETII40 μM4.6811.974.47
(2 μM)
QP425expAP3040 μM8.8689%8.19−32%2.93−35%
(2 μM)
QP425ctrlhTETII40 μM3.4226.722.46
(3 μM)
QP425expAP3040 μM6.2282%18.88−29%2.44−1%
(3 μM)
QP425ctrlhTETII40 μM4.2118.72.72
(5 μM)
QP425expAP3040 μM8.1493%14.84−21%2.39−12%
(5 μM)

Example 2. Evaluation of Pyrococcus horikoshii TET III Aminopeptidases

[0252]In this example, cutting performance was evaluated for AP37, a cleaving reagent comprising Pyrococcus horikoshii TET III Aminopeptidase (hTET III) and a C-terminal tag. hTET III is a homolog of PfuTET, which was used in these studies for comparative purposes relative to AP37. AP37 was expressed in E. coli and the cell free extract was resolved in talon affinity column in AKTA. FIG. 10A shows an example chromatogram showing AP37 enrichment and the eluted peak.

[0253]FIG. 10B shows talon affinity column purification fractions resolved on SDS PAGE gel to show AP37 separation. The eluted peak fractions with monomer (40.33 kDa) are shown with an arrow. Other bands above the monomer are different complexes of AP37 under the condition. Results obtained from HPLC assay data showed improvements in cleavage activity of AP37 after cobalt acetate and heat conditioning. Table 5 displays the activity data at 1 M and 10 M aminopeptidase concentration (before and after conditioning) on peptides with distinct N-terminal amino acid.

TABLE 5
Results from HPLC assay data
Percent N-Terminal Residue Cut
AP37 before conditioningAP37 after conditioning
Peptide1 μM10 μM1 μM10 μM
WKELDEESILKQK18559799
(SEQ ID NO: 167)
IAKLDEESILKQK135774100
(SEQ ID NO: 374)
RRLDEESILKQK82670100
(SEQ ID NO: 375)
KKLDEESILKQK117161100
(SEQ ID NO: 376)

[0254]A real-time cleavage kinetics assay was performed using amino acid-AMC (7-Amino-4-methylcoumarin) substrates, with cleavage kinetics followed in real time at excitation wavelength of 357 nm and emission wavelength of 450 nm, at 30° C. to measure the increase in fluorescence at 441 nm. FIG. 11 shows three bar charts comparing the inherent cleavage rates and substrate specificities by PfuTET and AP37 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart). The inherent cleavage rates were derived for each residue at an optimal concentration of aminopeptidase which were determined by aminopeptidase titration. The rates were calculated by exponential fits of the intensity change of the time course. These results showed that AP37 has faster inherent cleavage rates than PfuTET for individual amino acids.

[0255]A protein sequencing assay was performed with AP37 (40 PM) or PfuTET (40 PM) aminopeptidase, along with PS610 (50 nM), PS961 (250 nM), PS961 (250 nM) recognizers and QP514 (DQQRLIFAYPDDD) (SEQ ID NO: 49) on separate chips. FIG. 12A shows representative traces for reaction with AP37 or PfuTET showing RSs identified by the recognizers as the cleavage progressed. FIG. 12B shows plots showing cut depths and proportions of each RS recognized in the reads without gap (no missed recognizable residue). These results showed that AP37 shows better efficiency cleaving arginine than PfuTET when alone.

[0256]A protein sequencing assay was performed at two different AP37 concentrations (20 μM/40 μM), 4 μM hTETII, and PS610 (50 nM), PS557 (250 nM) and PS691 (100 nM) recognizers on QP433 (RLIFAYPDDD) (SEQ ID NO: 47). FIGS. 13A-13C show plots depicting the results from these studies, with changes calculated relative to PfuTET tested at the same concentration on the same chip. hTETII was kept at 4 μM in all conditions. FIG. 13A shows the improvements in cut depth. FIG. 13B shows improvements in % of important reads. FIG. 13C shows that AP37 reduced rapid sequential cleavage (RSC) of LI, IF, and FA RSs.

Example 3. Evaluation of AP30 and AP37 Aminopeptidase Combination

[0257]In this example, protein sequencing assays were performed to evaluate the combination of AP30 and AP37 in a sequencing reaction.

[0258]FIGS. 14A-14B show bar charts illustrating the effect of different AP30/AP37 proportions with PS610 (50 nM), PS691 (100 nM), and PS961 (250 nM) recognizers, on time to cleave DQQ motif and R residue (FIG. 14A) and RS rapid sequential cleavage (FIG. 14B). Increasing aminopeptidases concentration during sequencing of QP434 (DQQRLIFAG (SEQ ID NO: 373)) showed an increase in cleavage rate for both dark amino acids (DQQ motif) and for the visible amino acid R, which led to an increase in the rapid sequential cleavage of IF.

[0259]FIGS. 15A-15B show bar charts showing the distribution of the performance metrics (cut depth, % of 4+RSs reads, and % of 5 RSs reads) with the recognizers mix of PS610 (50 nM), PS961 (250 nM), and PS691 (100 nM), and AP30/AP37 at 4 μM/40 μM on QP514 (DQQRLIFAYPDDD) (SEQ ID NO: 49) (FIG. 15A, seven technical replicates) and at 10 μM /60 μM concentration on QP549 (DQQIASSRLAASFAAQQYPDDD1) (SEQ ID NO: 50) (FIG. 15B, six technical replicates). Standard recognizers and aminopeptidase conditions were used as a control on the same chip [PS610 (50 nM), PS557 (250 nM) PS621 (250 nM) and hTETII/PfuTET at 1 μM/40 μM for QP514 and at 3 μM/60 μM for QP549].

[0260]FIG. 16 shows reads breakdown and abundance of ungapped reads, with single deletion allowed in reads of length of 4, obtained from one of the chip runs by the recognizers and aminopeptidases mix of PS961/PS691 at 250/100 nM and AP30/hTETIII at 10/60 PM, on QP549. The updated combination of aminopeptidases and recognizers, on QP549 achieved unprecedented cut depth values of >9 cut depth for the top 10% of apertures in multiple runs. This run reached 10/10, with cut depth of 10.64 for the top % of apertures with single rapid sequential cleavage allowed in reads of length of 4.

Example 4. Evaluation of Yersinia pestis Xaa-Prolyl aminopeptidase (yPIP)

[0261]Xaa-Prolyl aminopeptidase (yPIP) from Yersinia pestis, also known as proline aminopeptidase PII, is a monomeric AP that has specific activity towards N-terminal X-P motifs. In this example, cutting performance was evaluated for a cleaving reagent comprising yPIP and a C-terminal 6× His-tag (SEQ ID NO: 6). yPIP (BC-B1 batch) was expressed in E. coli and the cell free extract was prepared after the cell lysis and resolved in talon affinity column in AKTA.

[0262]FIG. 17A shows an example chromatogram showing yPIP separation and the eluted peak. FIG. 17B shows Talon affinity column purification fractions resolved on SDS PAGE gel to show yPIP enrichment. The eluted peak fractions at 51 kDa are shown with an arrow.

[0263]FIGS. 18A-18B show representative traces showing the effect of adding yPIP (2 μm) in the AP30/AP37 (4/40 μM) aminopeptidase combination in a protein sequencing assay. The protein sequencing assay was carried out with (a) AP30 (1 μM)/AP37 (40 PM), and (b) AP30 (1 μM)/AP37 (40 μM)/yPIP (2 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. These results showed that yPIP in the AP30/AP37 aminopeptidase combination helps cleaves past the YP motif more efficiently.

[0264]FIGS. 19A-19B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (2 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. Bar plots are shown for the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels). These results showed that yPIP in the AP30/AP37 aminopeptidase combination cleaves past the YP motif reaching FA more efficiently.

[0265]FIGS. 20A-20B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (2 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. These results further demonstrated that yPIP in the AP30/AP37 aminopeptidase combination cuts past the YP motif reaching FA more efficiently.

[0266]FIGS. 21A-21B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP (0.5 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (1 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. The actual % FA should be higher for both yPIP concentrations, as FA is miscalled as YP. However, the density of FA miscalling is much higher for yPIP at 1 μM compared to FA miscalling for yPIP at 0.5 μM. Additionally, the YP cluster was denser for yPIP at 0.5 μM compared to the YP cluster for yPIP 1 μM. Taken together, these observations indicated that overall performance of yPIP at 1 μM was more favorable than yPIP at 0.5 μM under these reaction conditions. Bar plots are shown in FIGS. 21A-21B for the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels). A higher 1st YP and lower FA was indicative of inadequate cleavage (the higher the YP compared to FA; less YP cleavage); a lower 1st YP and higher FA was indicative of YP cleavage and YP deletions (the lower the YP compared to FA; higher the RSC); and a similar YP and FA was considered ideal (good YP cleavage and less RSC).

[0267]FIGS. 22A-22B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP (0.5 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP (1 μM) combinations along with PS610 (50 nM)/PS961 (125 nM) recognizers combinations along with PS610 (50 nM)/PS961 (125 nM) recognizers. These results indicated that yPIP at 1 μM shows better performance than 0.5 μM in AP30/AP37 combination under these reaction conditions.

[0268]FIGS. 23A-23B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP-BC_B1 (2 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP-470 (2 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. Bar plots are shown for the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels). yPIP470 was stored at ˜20 C for >18 months and showed similar performance compared to freshly purified yPIP-BC_B1 in terms of % FA reads. However, yPIP470 showed slight increase in RSC of 1st YP (i.e. lower YP followed by higher FA).

[0269]FIGS. 24A-24B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/yPIP-BC_B1 (2 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP-470 (2 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

Example 5. Evaluation of AP70 Yersinia pestis Xaa-Prolyl aminopeptidase

[0270]In this example, cutting performance was evaluated for AP70, which is a cleaving reagent comprising yPIP (truncated by two amino acids at the C-terminus) and a C-terminal GGS-6× His-tag (SEQ ID NO: 8). FIGS. 25A-25B show (A) yPIP and AP70 protein amino acid sequence alignment showing the C terminal 6×H tag (SEQ ID NO: 32) and GGS-6× His-tag (SEQ ID NO: 33), respectively, and (B) expression constructs for yPIP and AP70 with molecular weights of the proteins.

[0271]AP70 (BC-B1 batch) was expressed in E. coli and the cell free extract was prepared after the cell lysis and resolved in talon affinity column in AKTA. FIG. 26A shows an example chromatogram showing AP70 separation and the eluted peak. FIG. 26B shows talon affinity column purification fractions resolved on SDS PAGE gel to show AP70 enrichment. The eluted peak fractions at 51.56 kDa are shown with an arrow.

[0272]FIGS. 27A-27D show results from HPLC assays for QP734 (FPARAFAYPDDD) (SEQ ID NO: 52) peptide cleavage by AP70 at 10 μM (FIG. 27A), 5 μM (FIG. 27B), 1 μM (FIG. 27C), or 0.25 μM (FIG. 27D) after different conditioning treatments and unconditioned control. Reactions were resolved on a hydrophobic column in reverse phase HPLC. AP70 Pre-treatment Conditions: No treatment; 50° C., 30 min; 50° C.+Co2+5 mM, 30 min; 50° C.+Mg2+5 mM, 30 min. AP70 Pre-treatment Conditions: No treatment; 50° C., 30 min; 50° C.+Co2+5 mM, 30 min; 50° C.+Mg2+5 mM, 30 min.

[0273]FIGS. 28A-28D show results from HPLC assays for different peptide cleavage by AP30 (FIG. 28A) or AP70 (FIGS. 28B-28D) after different conditioning treatments and unconditioned control. AP70 Pre-treatment Conditions: No treatment; 50° C., 30 min; 50° C.+Co2+5 mM, 30 min; 50° C.+Mg2+5 mM, 30 min. HPLC Reaction Conditions: 200 μM Peptide; 30 min at 30° C.; Quench using Formic acid.

[0274]A real-time cleavage kinetics assay was performed using short peptide-AMC (7-Amino-4-methylcoumarin) substrates, with cleavage kinetics followed in real time at excitation wavelength of 357 nm and emission wavelength of 450 nm, at 30° C. to measure the increase in fluorescence at 441 nm. FIG. 29 shows three graphs comparing the cleavage activity and substrate specificities for AP70, AP30+AP37, and AP30+AP37+AP70 combinations on PXX, XPP, XPX peptides containing proline. The cleavage activities were derived for each peptide at optimal concentrations of aminopeptidases, which were determined by aminopeptidases titration.

[0275]FIG. 30 shows results from protein sequencing assay with AP70 (1 μM, 4 μM), no AP control, AP30 (4 μM) on QP734 (FPARAFAYPDDD) (SEQ ID NO: 52) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Apertures vs. Time plots display FP, RA and FA levels through the chip run (left panels). Bin Ratio vs. Pulse duration plots are shown with separated clusters for recognized RSs (right panels; arrow in third panel from top shows data which matches Bin ration of PS1122 but miscalled as FP).

[0276]FIGS. 31A-31B show representative traces from protein sequencing assays showing the effect of adding AP70 (1 μM) in the AP30/AP37 (4/40 μM) aminopeptidase combination. The protein sequencing assay was carried out with (A) AP30 (1 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (1 μM)/AP37 (40 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Table 6 shows results from AP70 concentration titration to optimize the AP30+AP37+AP70 AP combination performance on chips for QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) sequencing.

TABLE 6
Results from AP70 concentration titration
AP70AP70 with AP30/AP37 at 4/40 μM
ConcentrationOverall %
(μM)% 1st YP*% Last YP*% FA*FA Reached1
0.2521.462.469.1311.59
0.5019.182.368.5010.6
121.076.5316.8523.39
29.941.2212.9314.14
413.783.7918.0121.8
614.282.2911.2113.49
AP70AP30/AP37 at 4/40 μM
ConcentrationOverall %
(μM)% 1st YP*% Last YP*% FA*FA Reached1
0.25
0.50
149.040.723.223.95
2
469.241.592.694.28
6
*Reads with 1 gap allowed;

[0277]Results from additional runs performed to generate the data in Table 6 are shown in FIGS. 32A-32F. The runs of FIGS. 32A and 32B showed a similar performance at both AP70 concentrations. The runs of FIGS. 32E and 32F showed: (a) a similar performance for both concentrations of AP70 in terms of reads reached FA, and (b) for AP70 at 6 μM, RSC of both 1st and last YP increased, which was reflected in % YP reads being less as compared to AP70 at 2 PM.

[0278]FIGS. 33A-33B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. The presence of “FA” cluster with AP70 at 1 μM in combination with AP30/AP37 at 4/40 μM confirms that AP70 is able to cleave past the “Y-P” motif, thus increasing the cut depth. Also shown in FIGS. 33A-33B are bar plots displaying the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels).

[0279]FIGS. 34A-34B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM) and (B) AP30 (4 μM)/AP37 (40 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers.

[0280]FIGS. 35A-35B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations on QP354 (LAAYPARLAYPDDDF) (SEQ ID NO: 53) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. Also shown are bar plots displaying the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels). These results demonstrated that AP70 showed YP cleavage on an alternate peptide QP352.

[0281]FIGS. 36A-36B show reads proportion breakdown for the QP354 (LAAYPARLAYPDDDF) (SEQ ID NO: 53) protein sequencing assay with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. These results demonstrated that AP70 showed consistent performance on an alternate peptide of the same length as QP352.

[0282]FIGS. 37A-37B show results from protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 BC-B1 batch (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP BC-B1 batch (1 μM) combinations on QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) peptide along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. Bin Ratio vs. Pulse duration plot with separated clusters for recognized RSs are shown in top panels. Also shown are bar plots displaying the cut depths and proportion of each RS recognized in the reads without gap (middle panels) and with gaps (bottom panels). AP70 showed less RSC for the 1st YP and reached the last YP for both ungapped and gapped reads as compared to yPIP. Table 7 shows yPIP and AP70 performance comparison with AP37+AP70 AP combination for QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) sequencing.

TABLE 7
yPIP and AP70 performance comparison
Overall % FA
% 1st YP*% Last YP*% FA*Reached1
AP70 at 1 μM with AP30/AP37 at 4/40 μM
17.2823.0211.2714.28
yPIP at 1 μM with AP30/AP37 at 4/40 μM
10.392.1312.4314.57
*Gapped reads with 1 deletion allowed in reads;

[0283]FIGS. 38A-38B show reads proportion breakdown for the QP352 (RLAYPAFAAYPDDDF) (SEQ ID NO: 51) protein sequencing assays with (A) AP30 (4 μM)/AP37 (40 μM)/AP70 BC-B1 batch (1 μM), and (B) AP30 (4 μM)/AP37 (40 μM)/yPIP BC-B1 batch (1 μM) combinations along with PS610 (50 nM)/PS961 (125 nM)/PS1122 (250 nM) recognizers. These results demonstrated that AP70 shows less RSC for the 1st YP and reaches the last YP for both ungapped and gapped reads as compared to yPIP.

Example 6. Identification and Development of a Monomeric Aminopeptidase (AP64)

[0284]Based on extensive experimental studies relating to polypeptide sequencing reactions carried out using recognizers and aminopeptidase cleaving reagents, areas of improvement for aminopeptidase development were identified (FIG. 39A). As illustrated by the example sequencing runs shown in FIG. 39A, in some instances, amino acid cleavage by an aminopeptidase occurred before recognizers could bind the amino acid to produce a detectable signal, resulting in a missing region of interest (ROI) or deletion from the sequencing data. This was at least in part attributed to fast and non-uniform cleavage kinetics which limit the window of time within which recognizers are able to bind, providing too short of a duration for ROI calling.

[0285]Aminopeptidases (APs), such as hTETII and AP30, have a dodecameric tetrahedral structure and contain three active sites capable of cleavage. The missing ROIs observed with these APs were attributed to at least two potential mechanisms: (1) rapid inherent cleavage rates of an individual aminopeptidase active site in which fast rebinding of the active site for subsequent cleavage of the downstream residue occurs; and (2) rapid sequential cleavage (RSC) caused by multiple active sites in the vicinity of the N-terminal end of the peptide, where RSC is mediated for the newly exposed residue by the nearby active site not allowing ROI calling by recognizers. FIG. 39B shows a model for hTETII aminopeptidase assembly process (left); the dodecameric complex with three active sites (middle); and RSC demonstrated by Dodecameric APs combination (right) due to multiple active sites in close vicinity: sequencing of QP47 (FAAAYPDDD (SEQ ID NO: 46)) shows fast transition from FA to YP (red peak at left) via dark amino acids (AAA motif) in this run with PS610 recognizer.

[0286]To eliminate or limit the occurrence of missing ROIs observed with dodecameric APs, monomeric/small APs were evaluated. Monomeric APs contain a single active site, which according to the proposed mechanisms above could potentially reduce RSC. Additional possible improvements were expected, such as higher cleavage efficiency providing a fast and relatively uniform rate of cleavage at lower concentrations, smaller size permitting cleavage up to the end into most peptides, a homogenous molecular species providing more uniform activity and ease of preparation, and improved AP combinations.

[0287]An aminopeptidase, AP64, was designed based on the aminopeptidase from Streptomyces griseus, which is a monomeric metalloenzyme that is relatively small (30 kDa) and exhibits high activity and heat stability (FIG. 40A). Table 8 provides sequence information for AP64, including amino acid sequences for the catalytic domain of Streptomyces griseus Aminopeptidase (SEQ ID NO: 101) and AP64 (SEQ ID NO: 102), and the nucleotide sequence of the gene insert encoding AP64 (SEQ ID NO: 145). The amino acid sequence of AP64 corresponds to the catalytic domain of Streptomyces griseus Aminopeptidase (SEQ ID NO: 101) with a C-terminal tag sequence (SEQ ID NO: 43).

TABLE 8
AP64 Sequence Information
SEQ
NameSequenceID NO.
MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT101
TTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
AminopeptidaseVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
(amino acidNFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEGDGRSDHAPFKN
sequence)VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPT
AP64MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT102
(amino acidTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
sequence)VLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIETEGDGRSDHAPFKN
VGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPTGGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFE
AQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIEWHE
AP64ATGGCAGCGCCAGATATACCCCTAGCTAATGTCAAGGCGCACTTGACCCAGCT145
(nucleotideGAGCACCATTGCTGCGAACAATGGTGGAAACCGTGCCCATGGTCGTCCGGGTT
sequence)ACAAAGCGAGCGTGGATTACGTGAAGGCGAAACTGGACGCAGCCGGTTACACC
ACCACGCTTCAGCAATTTACGAGCGGTGGTGCGACCGGCTATAACCTGATTGC
GGACTGGCCGGGTGGTGACCCGAACAAAGTTCTGATGGCAGGCGCTCACCTCG
ACTCCGTTAGCTCTGGTGCGGGTATCAACGACAACGGCTCCGGCTCTGCGGCG
GTTCTGGAAACCGCGCTGGCTGTTAGCCGTGCAGGTTACCAGCCGGATAAACA
TCTGCGTTTTGCATGGTGGGGTGCGGAAGAACTGGGTCTGATCGGCTCCAAGT
ATTATGTTAATAACCTGCCGAGCGCGGATCGCAGCAAGCTGGCTGGCTACCTG
AACTTCGACATGATCGGTTCTCCGAATCCAGGCTACTTCGTGTATGATGACGA
CCCGGTTATTGAGAAAACCTTCAAAGATTATTTCGCGGGCTTGAACGTGCCGA
CTGAGATCGAGACTGAAGGCGATGGCCGTAGCGATCATGCTCCGTTTAAGAAC
GTGGGTGTCCCGGTAGGTGGTTTATTTACCGGTGCTGGTTACACCAAAAGCGC
GGCTCAAGCACAGAAGTGGGGTGGTACGGCTGGTCAGGCATTTGACCGCTGTT
ATCATAGCAGCTGCGATTCGCTGAGCAATATTAACGACACCGCGCTGGACCGC
AATTCTGATGCGGCCGCCCACGCGATTTGGACCTTATCAAGCGGCACCGGTGA
ACCGCCTACGGGCGGCAGTCATCACCATCACCATCACCACCACCACCACGGCG
GTGGCAGCGGCGGCGGCTCCGGCGGTGGTAGCGGTTTGAATGATTTTTTCGAG
GCACAAAAAATCGAGTGGCATGAAGGTGGCGGCTCCGGCGGCGGCTCGGGTGG
CGGATCTGGCTTGAACGACTTCTTCGAGGCGCAAAAGATCGAGTGGCACGAAT
AA

[0288]FIG. 40B shows Talon affinity column purification fractions resolved on SDS PAGE gel to show AP64 enrichment (the eluted peak fractions with purified monomer (35 kDa)). FIG. 40C shows example results from HPLC assay chromatogram for cleavage by AP64 and AP30 under same conditions on various peptides with distinct N-terminal amino acids.

[0289]A real-time cleavage kinetics assay was performed using amino acid-AMC (7-Amino-4-methylcoumarin) substrates, with cleavage kinetics followed in real time at excitation wavelength of 357 nm and emission wavelength of 450 nm, at 30° C. to measure the increase in fluorescence at 441 nm. FIG. 40D shows three bar charts comparing the inherent cleavage rates and substrate specificities by AP64 and AP30 for 18 individual amino acids categorized as per the activity level (high activity: left chart; moderate activity: middle chart; very low activity: right chart). FIG. 40E shows three bar charts comparing the inherent cleavage rates and substrate specificities by AP64, AP30 and AP37 for 18 individual amino acids categorized as per the activity level (high activity: top chart; moderate activity: middle chart; very low activity: bottom chart). For the results shown in FIGS. 40D-40E, inherent cleavage rates were derived for each residue at an optimal concentration of aminopeptidase determined by aminopeptidase titration, and rates were calculated by exponential fits of the intensity change of the time course.

[0290]FIGS. 41A-41D show results from on chip findings and validation for aminopeptidase combinations in 5-recognizer runs. FIG. 41A shows the sequencing kinetics for peptide QP1027 (RLAIQFAYPDDD (SEQ ID NO: 170)) in protein sequencing assay: (Left) AP30 (3 M)/AP37 (30 μM) vs. (Right) AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. Kinetic parameters are listed in the top and the respective sequencing traces are shown below for each side of sequencing run on the chip. The number of alignments is listed for each aminopeptidase combination, showing the significant increase in successful alignments using the new aminopeptidase combination of AP64/AP37 as compared to the combination of AP30/AP37.

[0291]FIG. 41B shows the sequencing kinetics for peptide QP1160 (FLARQAIWAQDDDK (SEQ ID NO: 172)) in protein sequencing assay: (Left) AP30 (3 M)/AP37 (30 μM) vs. (Right) AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. Kinetic parameters are listed at the top and the respective sequencing traces are shown below for each side of sequencing run on the chip. The number of alignments is listed for each aminopeptidase combination, showing the significant increase in successful alignments using the new aminopeptidase combination of AP64/AP37 as compared to the combination of AP30/AP37.

[0292]FIG. 41C shows the sequencing kinetics for peptide QP586 (FAQLQARFAADDD (SEQ ID NO: 173)) in protein sequencing assay: (Left) AP30 (3 M)/AP37 (30 μM) vs. (Right) AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. Kinetic parameters are listed at the top and the respective sequencing traces are shown below for each side of sequencing run on the chip. The number of alignments is listed for each aminopeptidase combination, showing the significant increase in successful alignments using the new aminopeptidase combination of AP64/AP37 as compared to the combination of AP30/AP37.

[0293]FIG. 41D shows a bar graph showing the % aligned reads/1k active apertures using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37, demonstrating improvement in alignments using AP64. Three synthetic peptides were used (QP1027, QP1160, QP586), 4 replicates per peptide. Error bars denote standard deviation; QP1027 (RLAIQFAYPDDD (SEQ ID NO: 170)), QP1160 (FLARQAIWAQDDDK (SEQ ID NO: 172)) and QP586 (FAQLQARFAADDD (SEQ ID NO: 173) peptides sequenced in protein sequencing assay: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers.

[0294]FIGS. 42A-42J show results from polypeptide sequencing runs using aminopeptidase combinations with AP64 compared to combinations without AP64 for sequencing different protein libraries.

[0295]FIG. 42A shows graphs showing the number of aligned reads for a CDNF human protein library sequencing run using the new AP combination of AP64/AP37 (Left panel) and the AP combination of AP30/AP37 (Right panel). Sequencing assay with the CDNF protein library: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers.

[0296]FIG. 42B shows graphs showing % aligned reads/1k active apertures for CDNF human protein library sequencing run (Left panels) and for individual peptides sequenced well (Right panels), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the CDNF protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42B, the combination using AP64 resulted in significantly increased alignments overall.

[0297]FIG. 42C shows graphs showing the relative change in the number of aligned reads/1k active apertures for CDNF human protein library sequencing run (Left panel) and for individual peptides sequenced well (Right panel), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the CDNF protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42C, the combination using AP64 resulted in significantly increased alignments overall.

[0298]FIG. 42D shows graphs showing the number of aligned reads for a PDL1 human protein library sequencing run using the new combination of AP64/AP37 (Left panel) and the aminopeptidase combination of AP30/AP37 (Right panel). Sequencing assay with the PDL1 protein library: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42D, the combination using AP64 resulted in significantly increased alignments overall.

[0299]FIG. 42E shows graphs showing the % of aligned reads/1k active apertures for PDL1 human protein library sequencing run (Left panels) and for individual peptides sequenced well (Right panels), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the PDL1 protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42E, the combination using AP64 resulted in significantly increased alignments overall.

[0300]FIG. 42F shows graphs showing the relative change in the number of aligned reads/1k active apertures for PDL1 human protein library sequencing run (Left panel) and for individual peptides sequenced well (Right panel), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the PDL1 protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42F, the combination using AP64 resulted in significantly increased alignments overall.

[0301]FIG. 42G shows graphs showing the number of aligned reads for HSA protein library sequencing run using the new combination of AP64/AP37 (Left panel) and the aminopeptidase combination of AP30/AP37 (Right panel). Sequencing assay with the HSA protein library: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42G, the combination using AP64 resulted in significantly increased alignments overall.

[0302]FIG. 42H shows graphs showing the relative change in the number of aligned reads/1k active apertures for HSA protein library sequencing run (Left panels) and for individual peptides sequenced well (Right panels), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the HSA protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42H, the combination using AP64 resulted in significantly increased alignments overall.

[0303]FIG. 42I shows graphs showing the relative change in the number of aligned reads/1k active apertures for HSA protein library sequencing run (Left panel) and for individual peptides sequenced well (Right panel), using the aminopeptidase combination of AP30/AP37 and the new combination of AP64/AP37. Sequencing assay with the HSA protein library, with 4 replicates. Error bars denote standard deviation: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers. As depicted in FIG. 42I, the combination using AP64 resulted in significantly increased alignments overall.

[0304]FIG. 42J shows: Left: A bar graph showing the % aligned reads/1k active apertures using the new AP combination of AP64/AP37, relative to the AP combination of AP30/AP37. Nine individual libraries were used in the study. As shown in FIG. 42J, improved alignment was observed for each protein library when using the AP64 combination, as compared to the previous AP30 combination. For CDNF, PDL1, MAPK3, GFAP, and HSA human protein libraries, error bars denote standard deviation from 4 replicate runs. Right: A bar graph shows False Discovery Rate (FDR) of the two AP combinations using 9 different protein libraries. CCL20, GMFB, IL26, IL34 are used as off-target references. The low values observed for the FDR, which is a measure of alignments which also aligned with peptide sequences of libraries not used in the experiment (off-target references), supported the reliability of the software's peptide sequence alignment. Sequencing runs: AP30 (3 M)/AP37 (30 μM) vs. AP64 (0.1 M)/AP37 (30 μM) combinations along with PS610, PS1223, PS1220, PS1165 and PS1259 recognizers.

[0305]FIGS. 42K-42S show amino acid sequences and results of sequencing runs of 9 individual proteins used in the study that provided the results shown in FIGS. 42A-42J: CDNF (FIG. 42K), PDL1 (FIG. 42L), MAPK3 (FIG. 42M), GFAP (FIG. 42N), NGAL (FIG. 42O), IL4 (FIG. 42P), VIME (FIG. 42Q), LMNB1 (FIG. 42R), and HSA (FIG. 42S). The numbers in red text denote the number of alignments seen for that peptide in the AP64/AP30 runs.

[0306]The results in this example demonstrated improved performance with the new aminopeptidase cleaving reagent, AP64, and the new aminopeptidase combination of AP37 and AP64. The use of AP64 in polypeptide sequencing reactions improved performance, as shown by: Reduced RSC while keeping fast rate of cleavage, providing higher accuracy in reads; Higher cut depth, providing more coverage with more and higher-quality alignments (accuracy); Higher cleavage efficiency, which can potentially reduce the sequencing run time and increase the output of the instrument; Higher uniformity in performance based on the homogenous molecular species of AP64; No conditioning required, no residual cobalt, and reduced concentration of aminopeptidase required, such as 40-times less AP64 required than AP30 on chip; and Cost reduction and improved performance for kits.

Example 7. Development of Engineered Variants of Streptomyces griseus Aminopeptidase

AP103 and AP206

[0307]Aminopeptidases AP103 and AP206 were designed based on the aminopeptidase from Streptomyces griseus (AP64) described in Example 6 to create an aminopeptidase with improved U/V/A cleavage activity and reduced F/Y cleavage rate. AP103 (SEQ ID NO: 109) contains E198V and F221N substitutions relative to AP64, and AP206 (SEQ ID NO: 124) contains E198V, F221N, and G201V substitutions relative to AP64. Table 9 provides sequence information for C-terminally tagged AP1033 and AP206.

TABLE 9
AP103 and AP206 Sequence Information
SEQ
NameSequenceID NO.
AP103 with C-MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT146
terminal tagTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
(amino acidVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
sequence)NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEGDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPTGGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFE
AQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIEWH
AP103 with C-ATGGCGGCGCCGGACATCCCGCTGGCGAACGTTAAGGCGCACCTGACCCAGCT147
terminal tagGAGCACCATTGCGGCGAACAACGGTGGCAACCGTGCGCATGGTCGTCCGGGTT
(nucleotideACAAAGCGAGCGTTGACTATGTGAAGGCGAAACTGGATGCGGCGGGTTACACC
sequence)ACCACCCTGCAGCAATTCACCAGCGGTGGCGCGACCGGCTATAACCTGATTGC
GGACTGGCCGGGTGGCGATCCGAACAAGGTTCTGATGGCGGGTGCGCATCTGG
ACAGCGTGAGCAGCGGTGCGGGCATTAACGATAACGGTAGCGGTAGCGCGGCG
GTTCTGGAGACCGCGCTGGCTGTGAGCCGTGCGGGTTACCAACCGGACAAACA
CCTGCGTTTTGCGTGGTGGGGCGCGGAGGAACTGGGTCTGATCGGCAGCAAGT
ACTATGTGAACAACCTGCCGAGCGCGGACCGTAGCAAACTGGCGGGTTACCTG
AACTTCGATATGATCGGTAGCCCGAACCCGGGCTACTTTGTTTATGACGATGA
CCCGGTGATCGAAAAGACCTTCAAGGATTACTTCGCGGGTCTGAACGTTCCGA
CCGAGATTGTGACCGAAGGTGATGGCCGTAGCGACCACGCGCCGTTCAAGAAC
GTGGGCGTTCCGGTGGGTGGCCTGAACACCGGTGCGGGTTACACCAAGAGCGC
GGCGCAGGCGCAAAAATGGGGTGGCACCGCGGGTCAGGCGTTTGACCGTTGCT
ATCACAGCAGCTGCGATAGCCTGAGCAACATCAACGATACCGCGCTGGACCGT
AACAGCGATGCGGCGGCGCATGCGATTTGGACCCTGAGCAGCGGTACCGGTGA
GCCGCCGACCGGTGGCAGCCACCACCATCATCACCACCACCACCATCATGGTG
GCGGTAGCGGCGGTGGCAGCGGTGGCGGTAGCGGTCTGAACGACTTCTTTGAA
GCGCAGAAGATCGAGTGGCACGAAGGCGGTGGCAGCGGTGGCGGTAGCGGCGG
TGGCAGCGGGCTGAACGATTTCTTTGAGGCGCAAAAAATTGAATGGCAC
AP206 with C-MAAPDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYT148
terminal tagTTLQQFTSGGATGYNLIADWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAA
(amino acidVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKYYVNNLPSADRSKLAGYL
sequence)NFDMIGSPNPGYFVYDDDPVIEKTFKDYFAGLNVPTEIVTEVDGRSDHAPFKN
VGVPVGGLNTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDR
NSDAAAHAIWTLSSGTGEPPTGGSHHHHHHHHHHGGGSGGGSGGGSGLNDFFE
AQKIEWHEGGGSGGGSGGGSGLNDFFEAQKIEWH
AP206 with C-ATGGCGGCGCCGGACATCCCGCTGGCGAACGTTAAGGCGCACCTGACCCAGCT149
terminal tagGAGCACCATTGCGGCGAACAACGGTGGCAACCGTGCGCATGGTCGTCCGGGTT
(nucleotideACAAAGCGAGCGTTGACTATGTGAAGGCGAAACTGGATGCGGCGGGTTACACC
sequence)ACCACCCTGCAGCAATTCACCAGCGGTGGCGCGACCGGCTATAACCTGATTGC
GGACTGGCCGGGTGGCGATCCGAACAAGGTTCTGATGGCGGGTGCGCATCTGG
ACAGCGTGAGCAGCGGTGCGGGCATTAACGATAACGGTAGCGGTAGCGCGGCG
GTTCTGGAGACCGCGCTGGCTGTGAGCCGTGCGGGTTACCAACCGGACAAACA
CCTGCGTTTTGCGTGGTGGGGCGCGGAGGAACTGGGTCTGATCGGCAGCAAGT
ACTATGTTAACAACCTGCCGAGCGCGGACCGTAGCAAACTGGCGGGTTACCTG
AACTTCGATATGATCGGTAGCCCGAACCCGGGCTACTTTGTTTATGACGATGA
CCCGGTGATCGAAAAGACCTTCAAGGATTACTTCGCGGGTCTGAACGTGCCGA
CCGAGATTGTGACCGAAGTGGATGGCCGTAGCGACCACGCGCCGTTCAAGAAC
GTGGGCGTTCCGGTGGGTGGCCTGAACACCGGTGCGGGTTACACCAAGAGCGC
GGCGCAGGCGCAAAAATGGGGTGGCACCGCGGGTCAGGCGTTTGACCGTTGCT
ATCACAGCAGCTGCGATAGCCTGAGCAACATCAACGATACCGCGCTGGACCGT
AACAGCGATGCGGCGGCGCATGCGATTTGGACCCTGAGCAGCGGTACCGGTGA
GCCGCCGACCGGTGGCAGCCACCACCATCATCACCACCACCACCATCATGGTG
GCGGTAGCGGCGGTGGCAGCGGTGGCGGTAGCGGTCTGAACGACTTCTTTGAA
GCGCAGAAGATCGAGTGGCACGAAGGCGGTGGCAGCGGTGGCGGTAGCGGCGG
TGGCAGCGGGCTGAACGATTTCTTTGAGGCGCAAAAAATTGAATGGCAC

[0308]AP64 was found to be most active at L/I/V and F/W/Y. To improve cleavage rates, a series of mutations were designed in the AP64 backbone. A real-time cleavage kinetics assay was performed using amino acid-AMC (7-Amino-4-methylcoumarin) substrates, with cleavage kinetics followed in real time at an excitation wavelength of 357 nm and an emission wavelength of 450 nm, at 30° C. to measure the increase in fluorescence at 441 nm. FIGS. 43A-43C show a comparison of the maximum possible cleavage rates and relative substrate specificities measured for AP37, AP64, AP103, and AP206 for 19 individual amino acids. For the results in FIGS. 43B-43C, individual amino acids were categorized as per the activity level (low activity: left chart; moderate activity: middle chart; high activity: right chart). Inherent cleavage rates were derived for each residue at an optimal concentration of aminopeptidase as determined by aminopeptidase titration, and rates were calculated by exponential fits of the intensity change over time. AP103 was identified as having reduced F/Y cleavage rates and new substrate specificity for G/D. AP206 was identified as having fast L/A/M/W/I/P/N/Q/V/G cleavage rates, broader specificity, and higher activity towards smaller hydrophobic A/G, polar N, and negatively charged residues D/E. FIGS. 44A-44B shows Talon affinity column purification fractions resolved in SDS PAGE gel to show AP206 enrichment.

[0309]Dynamic sequencing runs were performed to evaluate aminopeptidase combinations with six amino acid recognizers (PS610: 50 nM, PS1936: 250 nM, PS2225: 250 nM, PS2459: 250 nM, PS1751: 250 nM, and PS2195: 500 nM) and a six-human protein library mix to be sequenced (CDNF, PDL1, IL20, IL18R, NGAL, MAPK3). FIGS. 45A-45B show exemplary graphs of the number of aligned reads from sequencing runs using the aminopeptidase combination of AP64 (0.1 μM)/AP37 (40 μM) (FIG. 45A) or AP206 (1.5 μM)/AP37 (15 μM) (FIG. 45B). The results are summarized in Table 10. FIG. 46 shows that all six proteins in the six-human protein library mix saw improved sequencing using the AP206/AP37 combination, with an average increase of 58% in number of alignments. Additionally, as shown in FIG. 47, 23 peptides were identified in the six-human protein library mix, and the AP206/AP37 combination improved the number of reads from individual peptides by an average of 78%. Comparison of the pulse duration, number of pulses, and interpulse duration, and recognition site duration of 18 individual amino acids demonstrated that the AP206/AP37 combination improved cleavage rates at most motifs, compared to the AP64/AP37 combination (FIGS. 48A-48C). Due to the 3-fold reduction in AP37 concentration when combined with AP206, the activity for arginine cleavage was found to be significantly slower than the combination of AP64/AP37. The decreased cleavage rate for arginine (and aspartate/glutamate) with the AP206/AP37 combination was a significant improvement. The previous higher concentration of AP37, which in certain embodiments was optimal in certain respects when in combination with AP64, led to undesirably fast cleavage of arginine, aspartate, and glutamate. Without wishing to be bound by any particular theory, it is believed that in the AP206/AP37 combination, AP206 was capable of cleaving noncharged amino acids, thus relying less upon AP37 for this activity and desirably allowing for decreased AP37 concentration. This led to the beneficial decreased cleavage rate for R/D/E residues, which provides more uniform recognition segment durations across different amino acids in certain embodiments, and thus improved alignments and better cut depth. FIG. 48D shows a comparison of AP103 and AP64 recognition segment duration for 13 individual amino acids and demonstrates that AP103 shows slower cleavage at L/I/V and faster F/W/Y cleavage compared to AP64. FIG. 48E shows a comparison of AP206 and AP103 recognition segment duration for 11 individual amino acids and demonstrates that AP206 maintains the broad activity of AP103, restores cleavage rates of L/I/V, and reduces cleavage rates at F/Y compared to AP103.

TABLE 10
Sequencing run summary of AP64/AP37 and AP206/AP37
aminopeptidase combinations with the six-
human protein library mix sequenced (CDNF,
PDL1, IL20, IL18R, NGAL, MAPK3).
AP64 (0.1 μM)/AP206 (1.5 μM)/
ReplicateAP37 (40 μM)AP37 (15 μM)
1Alignments13,43817,895
Active apertures270,213192,019
Alignments/1k active49.793.2
apertures
2Alignments11,52414,983
Active apertures214,924156,689
Alignments/1k active53.695.6
apertures
3Alignments12,19515,934
Active apertures295,966314,102
Alignments/1k active41.250.8
apertures
4Alignments10,87114,252
Active apertures308,796315,817
Alignments/1k active35.245.1
apertures
5Alignments13,11216,909
Active apertures334,409311,838
Alignments/1k active39.254.2
apertures
6Alignments12,31316,818
Active apertures188,354214,038
Alignments/1k active65.3778.6
apertures

[0310]Similar dynamic sequencing runs were conducted with a library mix of four human proteins (VIME, RAB11B, SFN, LMNB1). FIGS. 49A-49B show exemplary graphs of the number of aligned reads of each of the 4 individual proteins using the aminopeptidase combination of AP64 (0.1 μM)/AP37 (40 μM) (FIG. 49A) or AP206 (1.5 μM)/AP37 (15 μM) (FIG. 49B). The results are summarized in Table 11. FIG. 50 shows that all four proteins in the four-human protein library mix saw improved sequencing using the AP206/AP37 combination, with an average increase of 62% in number of alignments. Additionally, as shown in FIG. 51, 17 peptides were identified in the four-human protein library mix and the AP206/AP37 combination improved the number of reads from individual peptides by an average of 76%. As discussed above, these improvements in sequencing alignments and reads with the AP206/AP37 combination relative to the AP64/AP37 combination can be rationalized by the cleavage activity of AP206 toward noncharged amino acids, thus relying less upon AP37 for this activity and desirably allowing for decreased AP37 concentration. This led to a beneficial decreased cleavage rate for R/D/E residues, which may in certain embodiments provide more uniform recognition segment durations across different amino acids, and thus improved alignments and better cut depth. Additionally, AP206 further retains the benefits of being a monomeric aminopeptidase having a single active site, which like AP64 advantageously avoids or greatly limits the occurrence of missing ROIs due to rapid inherent cleavage rates and/or rapid sequential cleavage as described in Example 6.

TABLE 11
Sequencing run summary of AP64/AP37 and
AP206/AP37 aminopeptidase combinations
with the four-protein library mix.
AP64 (0.1 μM)/AP206 (1.5 μM)/
Chip ReplicateAP37 (40 μM)AP37 (15 μM)
1Alignments21,43034,460
Active apertures274,039269,937
Alignments/1k active78.2127.7
apertures
2Alignments26,95638,577
Active apertures395,505370,081
Alignments/1k active68.2104.2
apertures
3Alignments22,23639,652
Active apertures343,849637,402
Alignments/1k active64.7107.9
apertures
4Alignments15,07820,169
Active apertures182,661152,106
Alignments/1k active82.5132.6
apertures
5Alignments21,84938,398
Active apertures322,250340,546
Alignments/1k active67.8112.8
apertures
6Alignments22,73132,323
Active apertures340,657319,681
Alignments/1k active66.7101.1
apertures

[0311]The aminopeptidase combination of AP206/AP37 was further evaluated as a three-aminopeptidase combination further including the X-P aminopeptidase, AP70 or AP95.

[0312]Dynamic sequencing runs were conducted to sequence a STIP1 peptide library using the six amino acid recognizers described previously. The sequencing reaction further included the aminopeptidase combination of AP206 (1.5 μM) and AP37 (15 μM) with or without AP70 (2 μM). FIGS. 52A-52D and Table 12 provide a summary of the sequencing results obtained on different chips.

TABLE 12
Sequencing run summary of AP206/AP37 aminopeptidase
combination with AP70 X-P aminopeptidase.
ActiveAlign-
ChipAPAperturesmentsPeptidesAlignments/1k
1LNo-X-P223,0384974622.3
RAP70 2 μM256,78068181026.6
2LAP70 2 μM305,4338892729.1
RNo-X-P228,5876904530.2

[0313]Dynamic sequencing runs were conducted to sequence a human protein UBB peptide library using the six amino acid recognizers described previously. The sequencing reaction further included the aminopeptidase combination of AP206 (1.5 PM) and AP37 (15 or 40 PM) with or without AP70 (2 μM) or AP95 (2 μM). One additional peptide in the UBB library was expected to benefit from the inclusion of an X-P aminopeptidase (AP70 or AP95) in the reaction. Certain runs were performed with a higher concentration of AP37 (40 PM) in the mixture, which was expected to aid in faster cleavage of D-Q-Q peptide motifs to achieve higher E-G-J peptide alignment. FIGS. 53A-53D and Table 13 provide a summary of the sequencing results obtained on different chips.

TABLE 13
Sequencing run summary of AP206/AP37 aminopeptidase
combination with AP70 or AP95 X-P aminopeptidases
X-PActive
ChipAP MixAPAperturesAlignmentsPeptidesAlignments/1k
Chip1, LAP206/AP37No-X-260,3585512321.2
1.5 μM/15 μMP
Chip1, RAP70248,1384640218.7
2 μM
Chip 2, LAP206/AP37No-X-222,0205747225.9
1.5 μM/15 μMP
Chip 2, RAP95274,8435693220.7
2 μM
Chip 3, LAP206/AP37AP70242,3826705327.7
1.5 μM/40 μM2 μM
Chip 3, RNo-X-326,4626175218.9
P
Chip 4, LAP206/AP37AP95203,2249926348.8
1.5 μM/40 μM2 μM
Chip 4, RNo-X-206,57510008248.4
P

[0314]Without wishing to be bound or limited by theory, the improved performance of AP103 and AP206 may be understood in part via structure-based modeling, which was used to identify putative substitution sites in AP64. FIG. 54A shows the recognition pocket of AP64 bound to a leucine substrate. Three side chain binding pocket residues were identified that can affect amino acid cleavage specificity: E198, G201, and F221. FIG. 54B shows the recognition pocket of a model of AP103 bound to a leucine substrate. AP103 comprises E198V and F221N substitutions relative to AP64. Based on structural analysis of a phenylalanine substrate in the AP64 recognition pocket (FIG. 54C), the substitution of F221 in AP103 was thought to prevent favorable 7r-7c interactions with phenylalanine and tyrosine substrates, leading to reduced F/Y cleavage rates.

[0315]FIG. 54D shows the recognition pocket of a model of AP206 bound to a leucine substrate. AP206 comprises E198V, F221N, and G201V substitutions relative to AP64. The G201V substitution was engineered to (a) increase hydrophobic interactions with leucine, isoleucine, valine, and alanine substrates, resulting in faster cleavage of these substrates, and (b) clash with phenylalanine and tyrosine substrates, decreasing cleavage rates for these substrates. As illustrated by FIG. 54E, the G201V substitution was designed to increase hydrophobic interactions between the position 201 side chain and incoming amino-terminal L/I/V/A substrates. This structure-based design was consistent with experimental observations showing faster cleavage of these amino-terminal substrates by AP206. The modeling-based design rationales were further confirmed by the analysis of structures obtained by X-ray crystallography.

[0316]The crystal structure of leucine-bound AP206 was determined to 2.1 Å resolution and analyzed by comparison with the crystal structure of leucine-bound AP64. The substrate binding pocket of AP64 includes residues E198, F221, and residues within a loop region spanning T199-R204 (FIG. 55A, top image). In AP64, the side chain of E198 interacts with the backbone of G201 and D202, stabilizing the conformation of the T199-R204 loop when substrate is bound (FIG. 55A, bottom image). The E198V substitution in AP206 results in a large conformation change in the T199-R204 loop, and the shape of the substrate binding pocket is greatly altered (FIG. 55B). The G201V substitution in AP206 decreases the size of the side chain binding pocket and increases hydrophobicity, consistent with the observed increased activity of AP206 for amino acids with smaller hydrophobic side chains such as L/I/V/A (FIG. 55C). The F221N substitution in AP206 removes hydrophobicity from the binding pocket, making the pocket larger and more polar and providing flexibility in substrate specificity, consistent with the higher activity toward A/S/G/T/N/Q/D/E substrates (FIG. 55D).

Development of AP103, AP206, and Related Mutational Variants of AP64

[0317]The aminopeptidase variants described in this example were designed based on analyses of crystal structures of Streptomyces griseus aminopeptidase (AP64) bound to phenylalanine or leucine substrates. A flexible loop region spanning residues G201-G203 was identified as a potential region for engineering to broaden the substrate specificity of the wild-type aminopeptidase (FIG. 56). The variant design strategy was in part aimed at increasing hydrophobicity in the substrate binding pocket to increase interactions with the side chains of leucine, isoleucine, valine, and alanine substrates. In addition to the residues in the G201-G203 loop region, other residues in the substrate binding pocket that were evaluated included M163, E198, E200, F221, and A224. Table 13 provides a list of variants that were designed in this example.

TABLE 13
Mutational variants of <i>Streptomyces griseus </i>aminopeptidase
Substitutions relative to <i>S. griseus</i>
Nameaminopeptidase (SEQ ID NO: 101)
AP87E198Q, F221W
AP88E198Q, F221Y
AP89E198N, F221W
AP90E198N, F221Y
AP101E198Q, E200Q, D202N
AP102E198L, F221M
AP103E198V, F221N
AP104E198V, F221D
AP188E198Q, F221Y
AP190E198V, F221N
AP192E198S, F221N
AP196E198S, F221N
AP197E198T, F221N
AP198E198V, F221N, M163L
AP199E198V, F221N, M163I
AP200E198V, F221N, M163F
AP201E198V, F221N, M163Y
AP202E198V, F221N, G201A
AP203E198V, F221N, G201F
AP204E198V, F221N, G201L
AP205E198V, F221N, G201I
AP206E198V, F221N, G201V
AP207E198V, F221N, A224F
AP208E198V, F221N, A224L
AP209E198V, F221N, A224I
AP210E198V, F221N, A224V
AP211F221N
AP212G201F
AP213G201Y
AP214G201L
AP215G201I
AP216G201V
AP217G201M
AP218G201N
AP219G201H
AP220G201E
AP221E198V, F221N, G201Y
AP222E198V, F221N, G201M
AP223E198V, F221N, G201N
AP224E198V, F221N, G201H
AP225E198V, F221N, G201E

[0318]Aminopeptidase variants were evaluated with a modified HTP real-time cleavage activity assay using amino acid-AMC peptides to measure relative cleavage activities and relative substrate preferences at a fixed aminopeptidase concentration.

[0319]FIGS. 57A-57D show a comparison of aminopeptidase variant cleavage activity over several minutes at a fixed aminopeptidase concentration for N-terminal leucine peptide substrate. Under the conditions, AP103 showed slower cleavage toward leucine as compared to AP64 (FIG. 57A), and variants having G201 substitutions showed increased leucine cleavage rates, with AP206 and AP202 showing the largest increase (FIG. 57B). Variants having substitutions at M163 or A224 showed decreased activity toward leucine (FIGS. 57C-57D).

[0320]FIGS. 57E-57H show a comparison of aminopeptidase variant cleavage activity for N-terminal alanine peptide substrate. Under the conditions, AP103 showed faster cleavage toward alanine as compared to AP64 (FIG. 57E), and variants having G201 substitutions showed further increased alanine cleavage rates (FIG. 57F). Variants having substitutions at M163 or A224 maintained activity toward alanine (FIGS. 57G-57H).

[0321]Dynamic sequencing chip runs were performed using AP103 or AP202 with six amino acid recognizers (as described further above) and a synthetic peptide mixture (“QP796”: EFLNRFY (SEQ ID NO: 377), “QP706”: VRFLEQQN (SEQ ID NO: 378), “QP798”: ENRLCYYLGA (SEQ ID NO: 379), “QP1088”: DQFRLA (SEQ ID NO: 380), and “QP335”: FQRIALNFA (SEQ ID NO: 381)). FIGS. 58A-58B show example sequencing results, including kinetic parameters, for QP796 and QP746 peptides. The results for the two peptides showed that, as compared to AP103 (FIG. 58A), AP202 (FIG. 58B) showed increased cleavage rates for N-terminal L, A, F, and Y. The overall sequencing results showed that AP202 showed increased cleavage rates for N-terminal L, I, V, F, Y, N, and Q (FIG. 58C).

[0322]Dynamic sequencing chip runs were performed using aminopeptidase combination AP64 (0.1 μM)/AP37 (30 μM) or AP216 (0.5 μM)/AP37 (30 μM) with six amino acid recognizers (as described further above) and a six-human protein library mixture (CDNF, PDL1, IL20, IL18R, NGAL, and MAPK3). FIGS. 59A-59B show example sequencing results, including kinetic parameters, for representative CDNF and PDL1 library peptides. The results for the two peptides showed that, as compared to the combination of AP64/AP37 (FIG. 59A), the combination of AP216/AP37 (FIG. 59B) showed increased cleavage rates for N-terminal L, I, and V and decreased cleavage rates for N-terminal F and Y. The overall sequencing results further confirmed that AP216 showed increased cleavage rates for N-terminal L, I, and V and decreased cleavage rates for N-terminal F and Y (FIG. 59C).

EQUIVALENTS AND SCOPE

[0323]In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.

[0324]Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein.

[0325]The phrase “and/or,” as used herein in the specification and in the claims, should be understood to mean “either or both” of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with “and/or” should be construed in the same fashion, i.e., “one or more” of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the “and/or” clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.

[0326]As used herein in the specification and in the claims, “or” should be understood to have the same meaning as “and/or” as defined above. For example, when separating items in a list, “or” or “and/or” shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as “only one of” or “exactly one of,” or, when used in the claims, “consisting of,” will refer to the inclusion of exactly one element of a number or list of elements. In general, the term “or” as used herein shall only be interpreted as indicating exclusive alternatives (i.e. “one or the other but not both”) when preceded by terms of exclusivity, such as “either,” “one of,” “only one of,” or “exactly one of.” “Consisting essentially of,” when used in the claims, shall have its ordinary meaning as used in the field of patent law.

[0327]As used herein in the specification and in the claims, the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, “at least one of A and B” (or, equivalently, “at least one of A or B,” or, equivalently “at least one of A and/or B”) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.

[0328]It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.

[0329]In the claims, as well as in the specification above, all transitional phrases such as “comprising,” “including,” “carrying,” “having,” “containing,” “involving,” “holding,” “composed of,” and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases “consisting of” and “consisting essentially of” shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03. It should be appreciated that embodiments described in this document using an open-ended transitional phrase (e.g., “comprising”) are also contemplated, in alternative embodiments, as “consisting of” and “consisting essentially of” the feature described by the open-ended transitional phrase. For example, if the application describes “a composition comprising A and B,” the application also contemplates the alternative embodiments “a composition consisting of A and B” and “a composition consisting essentially of A and B.”

[0330]Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.

[0331]This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.

[0332]Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.

[0333]The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.

Claims

1-141. (canceled)

142. A composition comprising:

a first cleaving reagent comprising an aminopeptidase from Pyrococcus horikoshii; and

a second cleaving reagent comprising an aminopeptidase from Streptomyces griseus.

143. The composition of claim 142, wherein the first cleaving reagent comprises an amino acid sequence that is at least 85% identical to SEQ ID NO: 3.

144. The composition of claim 142, wherein the first cleaving reagent comprises a first tag sequence attached to a terminal end of the aminopeptidase.

145. The composition of claim 144, wherein the first tag sequence is attached to the C-terminal end of the aminopeptidase, and wherein the first tag sequence is at least 80% identical to any one of SEQ ID NOs: 32-45.

146. The composition of claim 142, wherein the second cleaving reagent comprises an amino acid sequence that is at least 85% identical to SEQ ID NO: 101.

147. The composition of claim 142, wherein the second cleaving reagent comprises a second tag sequence attached to a terminal end of the aminopeptidase.

148. The composition of claim 147, wherein the second tag sequence is attached to the C-terminal end of the aminopeptidase, and wherein the second tag sequence is at least 80% identical to any one of SEQ ID NOs: 32-45.

149. The composition of claim 142, wherein the molar ratio of the first cleaving reagent to the second cleaving reagent in the composition is between about 10:1 and about 500:1.

150. The composition of claim 142, wherein the first cleaving reagent is present in the composition at a first concentration, wherein the second cleaving reagent is present in the composition at a second concentration, and wherein the first concentration is at least two-fold higher than the second concentration.

151. The composition of claim 150, wherein the first concentration is between about 10 μM and about 100 μM.

152. The composition of claim 151, wherein the second concentration is between about 0.01 μM and about 10 μM.

153. The composition of claim 142, further comprising:

a third cleaving reagent comprising an aminopeptidase from Yersinia pestis.

154. The composition of claim 153, wherein the third cleaving reagent comprises an amino acid sequence that is at least 85% identical to SEQ ID NO: 7.

155. A kit comprising:

the composition of claim 142; and

instructions for using the kit in a method of polypeptide analysis.

156. The kit of claim 155, further comprising one or more amino acid binding proteins not having peptide cleavage activity.

157. The kit of claim 156, wherein the one or more amino acid binding proteins comprise an amino acid binding protein selected from a ClpS protein, a UBR protein, and an Ntaq1 protein.

158. A method of polypeptide analysis, the method comprising:

(a) detecting a signal indicative of interactions between one or more amino acid binding proteins and a polypeptide; and

(b) contacting the polypeptide with the composition of claim 142 to induce cleavage of a terminal amino acid of the polypeptide.

159. An aminopeptidase having an amino acid sequence that is at least 80% identical to SEQ ID NO: 101, wherein the amino acid sequence comprises an amino acid substitution at one or more positions corresponding to M163, E198, E200, G201, D202, F221, and A224 of SEQ ID NO:

101.

160. A method of analysis of multiple polypeptides, the method comprising:

(a) loading the multiple polypeptides in a plurality of sample wells;

(b) contacting the multiple polypeptides with a composition comprising an aminopeptidase to induce cleavage of a terminal amino acid of a plurality of the multiple polypeptides;

(c) monitoring a signal for signal pulses corresponding to interactions between one or more amino acid binding proteins and the multiple polypeptides; and

(d) repeating steps (b) and (c),

wherein, in between each pair of successive repetitions of step (b) for a respective sample well, the monitoring a signal of step (c) results in signal pulse data corresponding to interactions between one or more amino acid binding proteins and a polypeptide of the multiple polypeptides that is loaded in the respective sample well, in at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the plurality of sample wells.